Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51a8 Olfactory Receptor

Gene Symbol Or51a8
Organism Mouse
Family 51
Subfamily a
Pseudo No
Location chr7:102,900,000-102,901,000 (+)
Aliases Olfr570

Sequence information


Nucleotide sequence

MILNTSEVEISSFLLIGIPGFEHMHIWISIPICLMYLTAILGNCTILCVIRTEPSLHEPM
YYFLSMLAFSDLGLSFSSIPTMLRIFLFNAMGISTDACIAQEFFIHGFTDMESSVLLIMS
FDRFVAIRHPLRYSAILTSSRVVQIGLAFSVKSILLVLPLPFTLKRLRYCNKRLLSHSYC
LHQDVMKLACSDNRVNFYYGLFVALCMMSDSVFIAVSYVFILKTVLGIASHGERLKALNT
CVSHICAVLIFYVPIITLATMHRFAKHKSPLAMILIADAFLLVPPLMNPIVYCVKTRQIR
VKVLEKLGLHSK


Conceptual translation

MILNTSEVEISSFLLIGIPGFEHMHIWISIPICLMYLTAILGNCTILCVIRTEPSLHEPM
YYFLSMLAFSDLGLSFSSIPTMLRIFLFNAMGISTDACIAQEFFIHGFTDMESSVLLIMS
FDRFVAIRHPLRYSAILTSSRVVQIGLAFSVKSILLVLPLPFTLKRLRYCNKRLLSHSYC
LHQDVMKLACSDNRVNFYYGLFVALCMMSDSVFIAVSYVFILKTVLGIASHGERLKALNT
CVSHICAVLIFYVPIITLATMHRFAKHKSPLAMILIADAFLLVPPLMNPIVYCVKTRQIR
VKVLEKLGLHSK