Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51aa2 Olfactory Receptor

Gene Symbol Or51aa2
Organism Rat
Family 51
Subfamily aa
Pseudo No
Location chr1:168,611,000-168,612,000 (-)
Aliases Olr106

Sequence information


Nucleotide sequence

ATGCTCCATATAAATATCACCAACTCCATCTTCTCCGCCTCCCTAGTTACAGGCATTCCA
GGGTTGGAGACAGTGTACATCTGGGTATCCATACCATTCTGTGCTATGTTCCTCATTACT
ATCGTGGGTAACATGACCATCATAATTGTTATCTGGCATGAGCAGACTCTTCATGTTCCT
ATGTATCTCATCTTGGCCATGTTAGCCTCCTCTGATCTGGGTCTCTCTCTCTTTACCTTC
CCCACTCTGTTGAGAATCTTCTTGCTGAATGCTAGAGAAGTGACAGCCTCTGCATGTTTC
ACACAGATGTTCTTTATTCACACTTTCCAAGTCCTTGAATCAGCTATCATTCTGGCAATG
GCCTTTGACCGGTACATGGCCATTTCCCGTCCACTTCATTATCACTCCATTCTTACCGAC
ACTGTGATTTCCAGGATAGGATTGTCTATTGTTGTACGAACCTTAGTTGTGCAGGTGCCT
CTCCCCATCCTCTTGAGGAGGCTGTACTTTTGTCATTCCAATGTACTATCTCATTCCTAC
CGTTTGCATCCTGACATCATAAAGCTCTCCTGCTCCAGTACTAGTGTCAACAGTATCTTT
GGACTCTTCGTGGTGCTTTCGACCGTGGGGCTTGACTTTCTCCTCATCCTCCTCTCATAC
GTATTGATTCTGAAAACAGTACTGTGTATGGCTTCCCACAGTGGCCGCCTCAAGGCTCTC
AACACCTGCATCTCTCATCTGTGTGCTGTGGTCCTCTTCTTCACACCCATGATCTGCCTA
TCCATGCTGCATCGTTTTGGTCCAAGGCTCCCCTCACATGTCTATGTGACCCTGGCCAAC
ATGCACTTTCTAATTCCTCCTGTGATGAACCCCATCGTCTATGTGGTGAAAACCAAGCAG
ATTCGTGACAAAATTCAGAAACTCTTTATTAAAAAAGCAACAGAGAAAGCTCGGGTTTCA
CCTATAACA


Conceptual translation

MLHINITNSIFSASLVTGIPGLETVYIWVSIPFCAMFLITIVGNMTIIIVIWHEQTLHVP
MYLILAMLASSDLGLSLFTFPTLLRIFLLNAREVTASACFTQMFFIHTFQVLESAIILAM
AFDRYMAISRPLHYHSILTDTVISRIGLSIVVRTLVVQVPLPILLRRLYFCHSNVLSHSY
RLHPDIIKLSCSSTSVNSIFGLFVVLSTVGLDFLLILLSYVLILKTVLCMASHSGRLKAL
NTCISHLCAVVLFFTPMICLSMLHRFGPRLPSHVYVTLANMHFLIPPVMNPIVYVVKTKQ
IRDKIQKLFIKKATEKARVSPIT