Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51aa5 Olfactory Receptor

Gene Symbol Or51aa5
Organism Mouse
Family 51
Subfamily aa
Pseudo No
Location chr7:103517414-103518382 (-)
Aliases Olfr611, MOR15-1, MOR15-4

Sequence information


Nucleotide sequence

ATGCTTCATGTCAACATCACCAACTCCATCTTCTCCACCTTCCTAGTTACAGGCATTCCA
GGTCTGGAGGCAGTGTACATCTGGATAGCCATACCATTCTGTGCCATGTTTCTCATCACT
ATGGTGGGTAACATGACCATTATAATTGTTATCTGGCATGAGCAGACTCTTCATGTTCCT
ATGTATCTATTCCTGGCCATGTTAGCCTCCTCTGATCTGGGTCTCTCTCTGTTTACCTTC
CCCACTCTGTTGAGAATCTTCCTGCTGAATGATAGAGAGTTGACCACCACTGCATGTTTC
ACACAGATGTTCTTCATTCACACTTTCCAAGACCTTGAATCAGCTATTATTCTGGCAATG
GCCTTCGATCGGTATGTGGCCATTTCTCACCCACTTCACTATCACTCCATTCTCACAGAC
ACTGTGATTGCCAAGATAGGGTTAGCTATTGTTGTACGAACCTTAACTCTGCAGGTGCCT
GCCCCTATCCTCTTGAGGAGGCTCTACTTTTGTCGTTCCAATGTACTATCTCATTCCTAC
TGTTTGCATCCTGACATCATAAAACTCTCCTGCTCCAGTACTACTGTCAACAGTATCTTT
GGACTCTTTGTGGTGCTCTCTACCTTGGGACTTGACTTCCTCCTCATCCTACTCTCATAT
GCATTGATTCTGAAAACAGTACTGAGTATGGCTTCCCACAGTGGCCGCCTCAAGGCTCTC
AACACCTGCATCTCTCATCTGTGTGCTGTGGTCCTCTTCTTCACACCCATGATCTGCCTA
TCCATGCTGCATCGTTTTGGTCCAAGGCTTCCCTCACATGTCTATGTGACCCTGGCCAAC
ATGCACTTTCTAATTCCTCCAGTGATGAACCCCATCGTCTATGTGGTGAAAACCAAGCAG
ATCCGTGACAAAATTCAGAAACTCTTCATTAGAAAAGCAACAAAGAAAGCTCAGGCTGCA
TCTATAACA


Conceptual translation

MLHVNITNSIFSTFLVTGIPGLEAVYIWIAIPFCAMFLITMVGNMTIIIVIWHEQTLHVP
MYLFLAMLASSDLGLSLFTFPTLLRIFLLNDRELTTTACFTQMFFIHTFQDLESAIILAM
AFDRYVAISHPLHYHSILTDTVIAKIGLAIVVRTLTLQVPAPILLRRLYFCRSNVLSHSY
CLHPDIIKLSCSSTTVNSIFGLFVVLSTLGLDFLLILLSYALILKTVLSMASHSGRLKAL
NTCISHLCAVVLFFTPMICLSMLHRFGPRLPSHVYVTLANMHFLIPPVMNPIVYVVKTKQ
IRDKIQKLFIRKATKKAQAASIT