Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51aa5 Olfactory Receptor

Gene Symbol Or51aa5
Organism Mouse
Family 51
Subfamily aa
Pseudo No
Location chr7:103,517,000-103,518,000 (-)
Aliases Olfr611

Sequence information


Nucleotide sequence

MLHVNITNSIFSTFLVTGIPGLEAVYIWIAIPFCAMFLITMVGNMTIIIVIWHEQTLHVP
MYLFLAMLASSDLGLSLFTFPTLLRIFLLNDRELTTTACFTQMFFIHTFQDLESAIILAM
AFDRYVAISHPLHYHSILTDTVIAKIGLAIVVRTLTLQVPAPILLRRLYFCRSNVLSHSY
CLHPDIIKLSCSSTTVNSIFGLFVVLSTLGLDFLLILLSYALILKTVLSMASHSGRLKAL
NTCISHLCAVVLFFTPMICLSMLHRFGPRLPSHVYVTLANMHFLIPPVMNPIVYVVKTKQ
IRDKIQKLFIRKATKKAQAASIT


Conceptual translation

MLHVNITNSIFSTFLVTGIPGLEAVYIWIAIPFCAMFLITMVGNMTIIIVIWHEQTLHVP
MYLFLAMLASSDLGLSLFTFPTLLRIFLLNDRELTTTACFTQMFFIHTFQDLESAIILAM
AFDRYVAISHPLHYHSILTDTVIAKIGLAIVVRTLTLQVPAPILLRRLYFCRSNVLSHSY
CLHPDIIKLSCSSTTVNSIFGLFVVLSTLGLDFLLILLSYALILKTVLSMASHSGRLKAL
NTCISHLCAVVLFFTPMICLSMLHRFGPRLPSHVYVTLANMHFLIPPVMNPIVYVVKTKQ
IRDKIQKLFIRKATKKAQAASIT