Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ab3 Olfactory Receptor

Gene Symbol Or51ab3
Organism Mouse
Family 51
Subfamily ab
Pseudo No
Location chr7:103,552,000-103,553,000 (+)
Aliases Olfr613

Sequence information


Nucleotide sequence

MSDVNTTSNWPTFSFIGIPGLEAAHMWISIPFCLLYLVALGGNFLLLLLVRAEQNLHEPQ
FYFLAMLALTDLGLSLSTMPSVLAIFWFDVHDVGLDACLTQMFFIHTLSSVESGVLVAMA
FDRLVAICAPLTYTRILNHQTVLCLSGAALIRGATLLAPLPFFLRTFPFCGANILSHSYC
YYPDMLNLACGDVTFSSVYGLVCVLCTFAVDVIFILVSYMKILGTVMKLGIQDRNWKSLQ
TCVCHLCTVLVFYLPLISLAVLHRYTQETSPILYTTMSNAYLLMTPLLNPLVYSLKSRQI
QAALHKRFGVQRVVAGE


Conceptual translation

MSDVNTTSNWPTFSFIGIPGLEAAHMWISIPFCLLYLVALGGNFLLLLLVRAEQNLHEPQ
FYFLAMLALTDLGLSLSTMPSVLAIFWFDVHDVGLDACLTQMFFIHTLSSVESGVLVAMA
FDRLVAICAPLTYTRILNHQTVLCLSGAALIRGATLLAPLPFFLRTFPFCGANILSHSYC
YYPDMLNLACGDVTFSSVYGLVCVLCTFAVDVIFILVSYMKILGTVMKLGIQDRNWKSLQ
TCVCHLCTVLVFYLPLISLAVLHRYTQETSPILYTTMSNAYLLMTPLLNPLVYSLKSRQI
QAALHKRFGVQRVVAGE