Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ab3 Olfactory Receptor

Gene Symbol Or51ab3
Organism Mouse
Family 51
Subfamily ab
Pseudo No
Location chr7:103551787-103552737 (+)
Aliases Olfr613, MOR20-1, Olfr613-ps1

Sequence information


Nucleotide sequence

ATGTCAGATGTGAATACTACTTCAAATTGGCCCACTTTTTCCTTCATTGGTATACCTGGT
CTAGAGGCTGCACATATGTGGATCTCCATCCCCTTCTGTCTCCTGTACCTGGTAGCACTT
GGGGGCAACTTTCTTCTCCTCCTTCTGGTTAGAGCGGAGCAGAATCTTCATGAACCCCAG
TTCTATTTTTTGGCCATGCTAGCCCTCACTGATCTTGGCCTCTCATTGTCAACAATGCCT
AGTGTCTTGGCCATCTTCTGGTTTGATGTCCATGATGTCGGTCTGGATGCCTGTCTGACA
CAAATGTTCTTTATTCACACACTGTCCTCTGTAGAGTCAGGTGTTCTGGTGGCCATGGCT
TTTGACCGCTTGGTTGCTATCTGTGCTCCACTAACCTACACTAGAATCCTGAATCACCAG
ACTGTGCTCTGCCTCAGTGGAGCTGCCCTCATACGAGGAGCCACTCTATTGGCCCCTTTG
CCATTTTTCCTCAGGACGTTTCCTTTTTGTGGGGCCAATATCCTCTCACACTCCTATTGT
TATTACCCAGATATGCTTAACTTGGCCTGCGGAGATGTCACATTCAGCAGTGTATACGGA
TTGGTCTGTGTACTCTGCACATTTGCAGTGGACGTAATCTTCATCTTAGTATCGTACATG
AAGATCTTGGGAACTGTGATGAAACTGGGGATCCAAGATCGAAACTGGAAATCCCTGCAA
ACCTGTGTCTGTCACCTCTGCACAGTGCTGGTGTTTTACTTGCCACTCATCAGCCTTGCA
GTACTGCATCGTTACACCCAGGAAACATCTCCAATTCTCTACACCACCATGAGCAATGCT
TACCTCCTCATGACCCCACTGCTAAACCCTCTGGTTTATAGCCTCAAATCCAGGCAGATC
CAAGCTGCCTTGCACAAGCGATTTGGAGTGCAACGTGTTGTTGCTGGGGAA


Conceptual translation

MSDVNTTSNWPTFSFIGIPGLEAAHMWISIPFCLLYLVALGGNFLLLLLVRAEQNLHEPQ
FYFLAMLALTDLGLSLSTMPSVLAIFWFDVHDVGLDACLTQMFFIHTLSSVESGVLVAMA
FDRLVAICAPLTYTRILNHQTVLCLSGAALIRGATLLAPLPFFLRTFPFCGANILSHSYC
YYPDMLNLACGDVTFSSVYGLVCVLCTFAVDVIFILVSYMKILGTVMKLGIQDRNWKSLQ
TCVCHLCTVLVFYLPLISLAVLHRYTQETSPILYTTMSNAYLLMTPLLNPLVYSLKSRQI
QAALHKRFGVQRVVAGE