Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51ab3 Olfactory Receptor

Gene Symbol Or51ab3
Organism Rat
Family 51
Subfamily ab
Pseudo No
Location chr1:168,623,000-168,624,000 (+)
Aliases Olr107

Sequence information


Nucleotide sequence

ATGTCAGATTTGAATGCTACTTTGAATTGTCCCACTTTTTCCTTCATTGGTATCCCTGGT
CTAGAGGCTGCACATATGTGGATCTCCATCCCCTTCTGTCTCCTGTACCTGGTAGCACTT
GGAGGCAATGTTCTTCTCCTCCTTCTGGTTAGAGCAGAGCAAAACCTTCATGAACCCCAA
TTCTATTTTTTGGCCATGTTAGCCCTCACAGACCTTGGCCTCTCACTGTCAACGATGCCT
AGTGTCTTGGCCATCTTCTGGTTTGATATTCATGATGTCGGTCTGGATGCCTGTCTGACA
CAAATGTTCTTTATTCACACTCTCTCCTCTGTAGAGTCAGGGGTTCTGGTGGCCATGGCT
TTTGACCGCTTGGTTGCTATCTGTGCTCCATTAACCTACACCAGAATCCTGAATCACCAT
ACTGTGGTCTGCCTCAGTGGAGCTGCCCTCATACGAGGAGCCACTTTATTGGCCCCTCTG
CCATTTTTCCTCAGGACGTTTCCTTTCTGTGGGGCCAATATCCTCTCACACTCCTATTGT
TACTACCCAGATATGCTTAACTTGGCCTGCGGCGATGTCACATTCAGCAGCGTCTATGGA
TTGGTCTGTGTGCTCTGCACATTTGCTGTGGACGCAATCTTCATCTTAGTTTCGTACATG
AAGATCTTGGGCACTGTGATGAAACTGGGGATCCAAGATCGAAACTGGAAATCGCTACAA
ACCTGTGTCTGTCACCTATGCACAGTTCTGGTGTTCTACTTGCCTCTCATCAGCCTTGCA
GTACTGCATCGTTACACCCAGGAAACATCTCCGATTCTCTACACCACCATGAGCAATGCC
TACCTCCTCATGACCCCACTGCTAAACCCGCTGGTTTATAGCCTCAAATCCAGGCAGATC
CAAGCTGCCTTGCGCAAGCGATTTGGAGTGCAACGTGTTGTTGCTGGGGAA


Conceptual translation

MSDLNATLNCPTFSFIGIPGLEAAHMWISIPFCLLYLVALGGNVLLLLLVRAEQNLHEPQ
FYFLAMLALTDLGLSLSTMPSVLAIFWFDIHDVGLDACLTQMFFIHTLSSVESGVLVAMA
FDRLVAICAPLTYTRILNHHTVVCLSGAALIRGATLLAPLPFFLRTFPFCGANILSHSYC
YYPDMLNLACGDVTFSSVYGLVCVLCTFAVDAIFILVSYMKILGTVMKLGIQDRNWKSLQ
TCVCHLCTVLVFYLPLISLAVLHRYTQETSPILYTTMSNAYLLMTPLLNPLVYSLKSRQI
QAALRKRFGVQRVVAGE