Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ac3 Olfactory Receptor

Gene Symbol Or51ac3
Organism Mouse
Family 51
Subfamily ac
Pseudo No
Location chr7:103,564,000-103,565,000 (-)
Aliases Olfr616

Sequence information


Nucleotide sequence

MEITNSSWFQPPTLLLTGIPGLEDVQIWFCIPLCVMYLIALLGNCTILFVIKTTSSLHEP
QYIFLSMLAATDVGLSVSTLPTVLNVFLLNHRDIEFHSCLTQMFFIHTFSSMESAILLAM
AFDRFVAIRNPLHYTAVLTPTRIIKIGLAAVVRGVMLMIPLPILLKRLPFCKGVILSHCY
CYHPDIMKLACGPVRVNIIYGLSLVLCSFGVDSVFIVISYILILKTVLGIASGDGKLKAL
NTCVSHIFTVFIFYVPLIVLALIHRFGTFASPLLHVTMANLFLFLTPVLNPLVYSLKTKQ
IRSAVCKIFKVWGNLLK


Conceptual translation

MEITNSSWFQPPTLLLTGIPGLEDVQIWFCIPLCVMYLIALLGNCTILFVIKTTSSLHEP
QYIFLSMLAATDVGLSVSTLPTVLNVFLLNHRDIEFHSCLTQMFFIHTFSSMESAILLAM
AFDRFVAIRNPLHYTAVLTPTRIIKIGLAAVVRGVMLMIPLPILLKRLPFCKGVILSHCY
CYHPDIMKLACGPVRVNIIYGLSLVLCSFGVDSVFIVISYILILKTVLGIASGDGKLKAL
NTCVSHIFTVFIFYVPLIVLALIHRFGTFASPLLHVTMANLFLFLTPVLNPLVYSLKTKQ
IRSAVCKIFKVWGNLLK