Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51ac3 Olfactory Receptor

Gene Symbol Or51ac3
Organism Rat
Family 51
Subfamily ac
Pseudo No
Location chr1:168,643,000-168,644,000 (-)
Aliases Olr109

Sequence information


Nucleotide sequence

ATGGAGATTACAAACAGTAGCTGGTTCCAGCCACCTACCCTTCTTCTAACAGGCATTCCT
GGACTAGAAGATGTGCAGATATGGTTCTGTATCCCACTATGTATCATGTACCTAATTGCC
CTGCTTGGAAACTGCACCATCCTCTTTGTTATCAAAACCACCTCCATTCTTCATGAGCCT
CAATACATATTCCTATCTATGCTGGCAGCTACAGACGTTGGTCTCTCTGTATCAACTCTG
CCTACGGTAATGAATGTCTTCCTCCTGAATCACAGAGATATTGAGTTCCATTCTTGCTTG
ACACAGATGTTCTTTATCCATACCTTTTCTTCCATGGAGTCAGCCATCCTACTGGCCATG
GCTTTTGACCGGTTTGTTGCTATTCGTAATCCATTACACTATACTGTAGTTTTAACTCCC
CCTAGGATTATCAGGATGGGACTTGCAGTTGTTGTTAGGGGTGTGGTGTTAATGGTCCCC
TTGCCAATCCTGCTCAAGAGGTTGCCTTTCTGTAAGGGTGTCATCCTGTCCCATTGTTAT
TGCTACCATCCTGACATCATGAAGCTGGCCTGTGGTCCTGTCAGGGTTAATATCATCTAT
GGATTGTCTCTAGTCCTCTGTTCCTTTGGAGTGGACTCTGTCCTTATTGTCATCTCTTAC
ATCTTGATTTTGAAAACAGTGCTGGGTATTGCCTCGGGAGATGGTAAGCTCAAGGCACTC
AACACCTGTGTCTCTCATATATTCACTGTCTTTATATTTTATGTCCCACTCATTGTTCTG
GCCCTAATTCACAGGTTTGGTACATTTGCATCCCCTCTCCTCCATGTCACCATGGCCAAT
CTTTTTCTCTTCTTGACTCCTGTTCTAAACCCCTTGGTTTATAGCCTAAAAACCAAACAG
ATAAGGTCTGCAGTGTGTAAAATATTTAACGTTTGGGGAAACTTGCTCAAA


Conceptual translation

MEITNSSWFQPPTLLLTGIPGLEDVQIWFCIPLCIMYLIALLGNCTILFVIKTTSILHEP
QYIFLSMLAATDVGLSVSTLPTVMNVFLLNHRDIEFHSCLTQMFFIHTFSSMESAILLAM
AFDRFVAIRNPLHYTVVLTPPRIIRMGLAVVVRGVVLMVPLPILLKRLPFCKGVILSHCY
CYHPDIMKLACGPVRVNIIYGLSLVLCSFGVDSVLIVISYILILKTVLGIASGDGKLKAL
NTCVSHIFTVFIFYVPLIVLALIHRFGTFASPLLHVTMANLFLFLTPVLNPLVYSLKTKQ
IRSAVCKIFNVWGNLLK