Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51af1 Olfactory Receptor

Gene Symbol Or51af1
Organism Mouse
Family 51
Subfamily af
Pseudo No
Location chr7:103,492,000-103,493,000 (-)
Aliases Olfr609

Sequence information


Nucleotide sequence

MSYSNHSSTSFFLTGLPGLETVYLWLSIPLCTMYIASLAGNGLILWVVKSEPSLHQPMYY
FLSMLAVTDLGLSVSTLPTMLTIYMMGVSEVALDMCLAQLFFIHTFSIMESSVLLTMAFD
RVVAISSPLHYATILTNPRVASLGMVILVRSIGLHIPAPIMLKKLPYCQKRHLSHSYCLH
PDVMKLACTDTRINSAYGLFVVLSTLGVDSVLIVLSYGLILYTVLSIASKTERLKALNTC
VSHICSVLLFYTPMIGLSMIHRFGKWASPCSRVLLSYLHFLTPPVLNPVVYTIKTKQIRQ
RIWRIFRCGGRSIGHIQGH


Conceptual translation

MSYSNHSSTSFFLTGLPGLETVYLWLSIPLCTMYIASLAGNGLILWVVKSEPSLHQPMYY
FLSMLAVTDLGLSVSTLPTMLTIYMMGVSEVALDMCLAQLFFIHTFSIMESSVLLTMAFD
RVVAISSPLHYATILTNPRVASLGMVILVRSIGLHIPAPIMLKKLPYCQKRHLSHSYCLH
PDVMKLACTDTRINSAYGLFVVLSTLGVDSVLIVLSYGLILYTVLSIASKTERLKALNTC
VSHICSVLLFYTPMIGLSMIHRFGKWASPCSRVLLSYLHFLTPPVLNPVVYTIKTKQIRQ
RIWRIFRCGGRSIGHIQGH