Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51af1 Olfactory Receptor

Gene Symbol Or51af1
Organism Rat
Family 51
Subfamily af
Pseudo No
Location chr1:168,586,000-168,587,000 (-)
Aliases Olr104

Sequence information


Nucleotide sequence

ATGTCTTACTCCAACCTTACTAGCCCCTCATTTTTTCTGATTGGCCTCCCTGGCCTTGAG
GCTGTGTATATCTGGCTCTCCATTCCTCTGTGTACCATGTATTTTGCCTCTCTGGCAGGG
AATAGCTTGATCCTGTGGGTTGTAAAGTCAGAACCCTCCCTGCACCAGCCTATGTACTAC
TTTCTATCCATGCTTGCAGTTACTGACCTCGGCCTGTCTGCCTCCACGATGCCTACCATG
CTCACTATCTACATGTTGGGTGTCAGCGAGGTGCCATTAGACATGTGCTTTGCACAGCTC
TTTTTCATCCATACCTTTTCCATCATGGAGTCATCTGTGCTGCTGACCATGGCCTTTGAC
CGTGTTGTGGCCATCAGCAGACCCCTACACTATGCCACCATCCTCACCAACCCTCGGGTT
GCAAGTTTGGGCGTGGTCATTTTGGTACGAAGCATTGGTCTCCACATCCCTGCCCCCATC
ATGCTGAAGAAGCTACCTTACTGCCAGAAGCATCATCTTTCTCACTCTTACTGCCTGCAC
CCAGATGTTATGAAGCTGGCCTGTACAGACACACAGATCAACAGTGCCTATGGCCTCTTT
GTGGTTCTCTCCACACTGGGTGTGGACTCTCTGCTCATCGTTTTATCCTATGGGCTGATC
CTCCACACAGTACTGTCAATCGCTTCCAAGACTGAGCGTCTCAAAGCCCTCAACACCTGT
GTGTCCCATATCTGTTCTGTGCTGCTATTCTACACACCTATGATTGGCCTTTCTATGATC
CACCGATTTGGCAAATGGGCTTCCCCCTGCAGCCGTGTGTTGCTCTCTTATCTTCACTTT
CTCACCCCGCCAGTGCTCAACCCAGTTGTTTACACCATAAAAACCAAGCAGATCCGCCAA
AGGATTTGGCGCATCTTCTGGTCTGGTGGAGGAAGCACTGGGCACATCCAGGGTCAC


Conceptual translation

MSYSNLTSPSFFLIGLPGLEAVYIWLSIPLCTMYFASLAGNSLILWVVKSEPSLHQPMYY
FLSMLAVTDLGLSASTMPTMLTIYMLGVSEVPLDMCFAQLFFIHTFSIMESSVLLTMAFD
RVVAISRPLHYATILTNPRVASLGVVILVRSIGLHIPAPIMLKKLPYCQKHHLSHSYCLH
PDVMKLACTDTQINSAYGLFVVLSTLGVDSLLIVLSYGLILHTVLSIASKTERLKALNTC
VSHICSVLLFYTPMIGLSMIHRFGKWASPCSRVLLSYLHFLTPPVLNPVVYTIKTKQIRQ
RIWRIFWSGGGSTGHIQGH