Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51af1b-ps Olfactory Receptor

Gene Symbol Or51af1b-ps
Organism Rat
Family 51
Subfamily af
Pseudo Yes
Location chr1:168526305-168527460 (+)
Aliases Olr99-ps

Sequence information


Nucleotide sequence

CATTTCGAAGAGTCCTTATAAGTTATCAGTCAGAATTTCTGACACAGGAACTCTCTAGGC
TTGGGTACTGTGTTTACTGTTGATCTTGGATCCCTCCATAGCAGTCACCATTTCTTACTC
CAAACTTTCTAGTGCCTCATTTTTTCTGACTGGCCTCCCTGTCCTTGAGGCTGTTTGTAA
CTGGCTCTCCATTCCTCTGTGTAGCATATATGTTGCCTCTCTAGCAGGGAATGGCTTGAT
CTTCTGGGTTTTAAAAATCAGAGCCCTCCCTGCACCAGCCTATGTACTATTTTCTATCCA
TTCTTGCAGTTACTGACCTTGACCTGTCTGCCTCCACTATGCCTACCATGCTCACTATCT
ACATGTTGAGGTCAGCAAGGTGGCATTTGACATGTGTCTTGCAAAATTCTTCATCCATAC
CTTCTCCATCATGGAGTCACCTGTGCTGCTGACCATGGCCTTTGACCATGTTGTGGCCAT
CAGCAGTCCCCTACACTATGCCACCATCCTCACCAACCCTTGCGTTGCAAGTTTGGGCTT
GGCCATTTTGGTATGAAGCATTGGTCTCCACAGCCCTGCCCCCATCATGCTGAAGAAGCT
ACCTTACTGCCAGAAGCATCATCTTTCTCACTCTTACTGCCTGCACCCAGATGTTATGAA
GCTGGCCTGTACAGACACCCACATCAGCAGTGCCTATGGCCTCTTTGTGGTTCTCTCCAC
ACTGGGTGTGGACTCTCTGCTCATCCTTTTATCCTATGGGCTGATCCTCCACACAGTACT
GTCAATCGCTTCCAAGACTGGGCGTCTCAAAGCCCTCAACACCTGTGTCTCCCATATCTG
TTCTGTGCTGCTATTCTACACACCTATGATTGGCCTTTCTATGATCCACCAATTGGCAAA
TGGGCTTCCCCCTGCAGCCGTGTGTTGCTCTCTTATCTTCACTTTCTCACCCCGCCAGTG
CTCAACCCAGTTGTTTACACCATAAAAACCAAGCAGAGGATTTGGCGCATCTTCTGGTCT
GGTGGAGGAAGCACTGGGCACATCCAGGGTCACTAAATCTTCTTCCTTGCAGATACAAAC
GTGGAGTGAGCTATAGCTTCTATTCTGCATATTAATTAAGAGTCATATGGTAGACATTAT
AACCGAATATATGACT


Conceptual translation

ISYSKLSSASFFLTGLPVLEAVCNWLSIPLCSIYVASLAGNGLIFWVLKI\PSLHQPMY
YFLSILAVTDLDLSASTMPTMLTIYMLRSA/VAFDMCLAKFFIHTFSIMESPVLLTMAF
DHVVAISSPLHYATILTNPCVASLGLAILV*SIGLHSPAPIMLKKLPYCQKHHLSHSYCL
HPDVMKLACTDTHISSAYGLFVVLSTLGVDSLLILLSYGLILHTVLSIASKTGRLKALNT
CVSHICSVLLFYTPMIGL/YDPPIGKWASPCSRVLLSYLHFLTPPVLNPVVYTIKTKQ