Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51af1c-ps Olfactory Receptor

Gene Symbol Or51af1c-ps
Organism Rat
Family 51
Subfamily af
Pseudo Yes
Location chr1:168,554,000-168,555,000 (-)
Aliases Olr102-ps

Sequence information


Nucleotide sequence

TGTGGTCCTCTACACTATGCCACCATCCTCACCAACCCTCAGGTTGCAAGTTTGGGCATG
GCCATTTTGGTATGAAGCATTGGTCTCCACAGCCCTGCCCCTATCATGCTGAAGAAGCTA
CCTTACTGCCAGAAGCATCATCTTTCTCAATCTTACTGCCTGCACCCAGATGTTATGAAG
CTGGCCTGTACAGACACCCACATCAGCAGTGCCTATGGCCTCTTTGTGGTTCTCTCCACA
CTGGGTGTGGACTCTCTGCTCATCCTTTTATCCTATGGGCTGATCCTCCACACAGTACTG
TCAATCGCTTCCAAGACTGGGCGTCTCAAAGCCCTCAACACCTGTGTGTCCCATATCTGT
TCTGTGCTGCTATTCTACACACCTATGATTGGCCTTTCTATGATCCACCAATTTGGCAAA
TGGGCTTCCCCCTGCAGCTGTGTGTTGCTCTCTTATCTTCACTTTCTCACCCCGCCAGAG
CTCAACCCAGTTGTTTACACCATAAAAACCAAGCAGATCCGCCAGAGGATTTGGCGCATC
TTCTGGTCTGGTGGAGGAAGCACTGGGCACATCCAGGGT


Conceptual translation

\SFFLTGLHGLEAACNWLFIPLCTMYVASLAGNGLIFWVLKI\PSLHQPMYYFLSMLA
VTDLDLFASTMPTMLT/LQVEVSKVAFGMCLAQFFIHTFSIMESSVLLTMAFDR/CGP
LHYATILTNPQVASLGMAILV*SIGLHSPAPIMLKKLPYCQKHHLSQSYCLHPDVMKLAC
TDTHISSAYGLFVVLSTLGVDSLLILLSYGLILHTVLSIASKTGRLKALNTCVSHICSVL
LFYTPMIGLSMIHQFGKWASPCSCVLLSYLHFLTPPELNPVVYTIKTKQIRQRIWRIFWS
GGGSTGHIQG