Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ag1 Olfactory Receptor

Gene Symbol Or51ag1
Organism Mouse
Family 51
Subfamily ag
Pseudo No
Location chr7:103,506,000-103,507,000 (-)
Aliases Olfr610

Sequence information


Nucleotide sequence

MAISKHSNASSFFFILMDLPGLETSHCWTAIPICLIYVLSVLGNITIMHIVKSVPSLHTP
MYLFLSMLSMADLGLSASTLPSMVAVFLLGQRMIGAVACFMQLFFIHTFSVIESAVLLAM
AFDRCVAIREPLRYATILTTRRIGAIGLAVVIRSAALHLPLPVLLGRLTFQPVSALSHSY
CVHPDVLRLSCSSTLVNSGFGLFVMLSTLGMDAVLILLSYVLILKTVLSIASNAERLKAF
NTCISHICAVLLFYTPLVSLSMIHRFGKKKLPAQVYMFLSYLHFLMPPMLNPIVYSVKTK
EIRVRILKMLHPKKH


Conceptual translation

MAISKHSNASSFFFILMDLPGLETSHCWTAIPICLIYVLSVLGNITIMHIVKSVPSLHTP
MYLFLSMLSMADLGLSASTLPSMVAVFLLGQRMIGAVACFMQLFFIHTFSVIESAVLLAM
AFDRCVAIREPLRYATILTTRRIGAIGLAVVIRSAALHLPLPVLLGRLTFQPVSALSHSY
CVHPDVLRLSCSSTLVNSGFGLFVMLSTLGMDAVLILLSYVLILKTVLSIASNAERLKAF
NTCISHICAVLLFYTPLVSLSMIHRFGKKKLPAQVYMFLSYLHFLMPPMLNPIVYSVKTK
EIRVRILKMLHPKKH