Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ag1 Olfactory Receptor

Gene Symbol Or51ag1
Organism Mouse
Family 51
Subfamily ag
Pseudo No
Location chr7:103506000-103506944 (-)
Aliases Olfr610, MOR9-2

Sequence information


Nucleotide sequence

ATGGCAATTTCTAAACATAGTAATGCCAGCAGCTTCTTTTTCATATTAATGGATCTTCCT
GGACTGGAGACTTCTCATTGCTGGACAGCAATACCCATCTGCTTAATTTACGTTCTTTCT
GTGCTGGGCAACATAACCATAATGCATATTGTCAAGTCTGTGCCCAGCCTTCACACACCT
ATGTACCTGTTTCTTTCCATGCTGTCGATGGCTGACCTGGGCCTCTCAGCTTCTACATTG
CCTTCAATGGTAGCTGTTTTCCTCCTGGGCCAGAGAATGATAGGAGCTGTAGCCTGTTTT
ATGCAACTCTTCTTCATCCACACATTTTCAGTCATCGAGTCAGCCGTTCTCTTGGCCATG
GCTTTTGACCGCTGTGTGGCCATCAGAGAGCCTTTGCGTTATGCTACTATTCTCACAACA
AGACGTATTGGGGCCATTGGACTGGCTGTGGTGATCCGCAGTGCTGCCCTTCATCTCCCT
TTGCCTGTGCTCCTGGGAAGACTGACGTTCCAGCCTGTCAGTGCTCTGTCTCATTCATAC
TGTGTTCATCCCGATGTCCTAAGGCTGTCCTGTTCCAGCACACTTGTCAACAGTGGCTTT
GGGCTCTTTGTCATGCTCTCTACATTGGGGATGGATGCGGTGCTAATTCTCCTCTCCTAT
GTGCTGATTTTGAAGACAGTCCTGAGCATTGCTTCTAATGCTGAGCGATTGAAAGCCTTC
AACACTTGCATTTCCCACATTTGTGCTGTTCTTTTATTTTATACCCCACTGGTGAGTCTG
TCTATGATCCACCGCTTTGGGAAAAAGAAACTACCAGCTCAGGTATACATGTTTCTCTCT
TATCTTCATTTCCTTATGCCCCCAATGCTCAACCCAATTGTCTACAGTGTCAAAACCAAA
GAGATTCGAGTTCGCATTCTAAAGATGCTCCATCCTAAGAAACAT


Conceptual translation

MAISKHSNASSFFFILMDLPGLETSHCWTAIPICLIYVLSVLGNITIMHIVKSVPSLHTP
MYLFLSMLSMADLGLSASTLPSMVAVFLLGQRMIGAVACFMQLFFIHTFSVIESAVLLAM
AFDRCVAIREPLRYATILTTRRIGAIGLAVVIRSAALHLPLPVLLGRLTFQPVSALSHSY
CVHPDVLRLSCSSTLVNSGFGLFVMLSTLGMDAVLILLSYVLILKTVLSIASNAERLKAF
NTCISHICAVLLFYTPLVSLSMIHRFGKKKLPAQVYMFLSYLHFLMPPMLNPIVYSVKTK
EIRVRILKMLHPKKH