Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ah3 Olfactory Receptor

Gene Symbol Or51ah3
Organism Mouse
Family 51
Subfamily ah
Pseudo No
Location chr7:103560479-103561417 (+)
Aliases Olfr615, MOR19-2

Sequence information


Nucleotide sequence

ATGTCTGAATTTAATACCACATTTCAACCTTCTGTCTTCATCCTCACTGGCCTCAGAGGG
CTGGTGGGTGCCCGCCTGTGGCTGGGACCACTCCTGAGCCTGATGTACATCACCACATTG
GCAGGGAACTGTACTGTAATTTATTTAGTAAGGACTGAAAGGAGTCTGCAGGAGCCTCAG
TACCAATTTTTGTCTATGCTGGCTGGGGCTGACATTGTCTTGTCTGTCTCTACACTGTTC
TCTGTGCTAAAAGTCTTTATCTTTGACCTCTATGAAATTGCATTTGACAGTTGCCTTGCT
CAGCTCTTCTTCATCCATACATCTTCTTCCATGGGTTCAGGAATCTTGTTAGCTATGGCT
TTTGACCGCTTTGTGGCCATCAGTCACCCCCTGCAATATACAACAATACTGACGAACTCA
CGAGTCACCAGGATGGGACTGGCAGCTTTTCTGAGGGGTGTAGCGCTCATGATGCCCTTG
CCTATACTGCTTAAGAGATTACCATTCTGCAAGGGGCAGCTGTTGTCCTACTCCTACTGT
ATCCACCCAAATGTCATGAAACTAGCCTGTGGCCAAGTCAAGATCAATATTTTCTATGGT
CTTGTTTTGGTTATATTTTCGTTTGGGGTGGACTTTTTGCTCATAGCTATTTCTTATGCT
CTGATATTTCAAGCAGTTATGGGGATCGCTTCTAGAGAAGGTCAGATGAAAGCGCTCAAT
ACTTGTTTGTCTCATATCTTTATTGTCTTTATCTACTATGGCCCTTTGCTGGCAATAACT
GTAATGCATCGGATCAGCCGCAGAAGTTCTCCAATAGCACATGCAGTCCTGGGAAATATC
TATCTTTTTATGCCCCCAATGCTTAACCCAATTGTGTATAGCCTGAAGACCAAGCAGATT
CGCTCTGCCTTGAGAAAATCTTTGAAGATCCAGAGGAGA


Conceptual translation

MSEFNTTFQPSVFILTGLRGLVGARLWLGPLLSLMYITTLAGNCTVIYLVRTERSLQEPQ
YQFLSMLAGADIVLSVSTLFSVLKVFIFDLYEIAFDSCLAQLFFIHTSSSMGSGILLAMA
FDRFVAISHPLQYTTILTNSRVTRMGLAAFLRGVALMMPLPILLKRLPFCKGQLLSYSYC
IHPNVMKLACGQVKINIFYGLVLVIFSFGVDFLLIAISYALIFQAVMGIASREGQMKALN
TCLSHIFIVFIYYGPLLAITVMHRISRRSSPIAHAVLGNIYLFMPPMLNPIVYSLKTKQI
RSALRKSLKIQRR