Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ah3 Olfactory Receptor

Gene Symbol Or51ah3
Organism Mouse
Family 51
Subfamily ah
Pseudo No
Location chr7:103,560,000-103,561,000 (+)
Aliases Olfr615

Sequence information


Nucleotide sequence

MSEFNTTFQPSVFILTGLRGLVGARLWLGPLLSLMYITTLAGNCTVIYLVRTERSLQEPQ
YQFLSMLAGADIVLSVSTLFSVLKVFIFDLYEIAFDSCLAQLFFIHTSSSMGSGILLAMA
FDRFVAISHPLQYTTILTNSRVTRMGLAAFLRGVALMMPLPILLKRLPFCKGQLLSYSYC
IHPNVMKLACGQVKINIFYGLVLVIFSFGVDFLLIAISYALIFQAVMGIASREGQMKALN
TCLSHIFIVFIYYGPLLAITVMHRISRRSSPIAHAVLGNIYLFMPPMLNPIVYSLKTKQI
RSALRKSLKIQRR


Conceptual translation

MSEFNTTFQPSVFILTGLRGLVGARLWLGPLLSLMYITTLAGNCTVIYLVRTERSLQEPQ
YQFLSMLAGADIVLSVSTLFSVLKVFIFDLYEIAFDSCLAQLFFIHTSSSMGSGILLAMA
FDRFVAISHPLQYTTILTNSRVTRMGLAAFLRGVALMMPLPILLKRLPFCKGQLLSYSYC
IHPNVMKLACGQVKINIFYGLVLVIFSFGVDFLLIAISYALIFQAVMGIASREGQMKALN
TCLSHIFIVFIYYGPLLAITVMHRISRRSSPIAHAVLGNIYLFMPPMLNPIVYSLKTKQI
RSALRKSLKIQRR