Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51ah3 Olfactory Receptor

Gene Symbol Or51ah3
Organism Rat
Family 51
Subfamily ah
Pseudo No
Location chr1:168,639,000-168,640,000 (+)
Aliases Olr108

Sequence information


Nucleotide sequence

ATGTCTGAATTTAATACCACATTTCAACCTTATGTCTTCATCCTCACTGGCCTCAGAGGG
CTGGTGGGTGCCCGCCTATGGCTGGGACCACTCCTGAGCCTAATGTACATCACCACATTG
GCAGGGAACTGTACTGTAATTTACTTAGTGAGGACTGAAAGGAGTCTGCAGGAGCCCCAG
TACCATTTTTTGTCTATGTTGGCTGGGGCTGACATTGTTCTGTCTGTCTCCACGCTGTTC
TCGGTGCTAAAAGTTTTTATCTTCGACTTCTATGAAATTGCATTTGATAGTTGTCTTGCT
CAGCTCTTCTTCATCCATGCATCTTCTTCCATGGGCTCGGGAATCTTGTTAGCTATGGCT
TTTGACCGCTTTGTGGCCATCAGTCACCCACTGCAATATACGACTATACTAACCAGCTCA
CGAGTCACCAAGATGGGGCTGGCAGCTTTTCTGAGGGGTGTGGCACTCATGATGCCCTTA
CCTATTCTGCTCAAGAGGCTACCATTCTGCAAGGGGCAGATGCTGTCCTACTCCTACTGT
ATCCACCCAAATGTCATGAAACTAGCTTGTGGCCAAGTCAAGATCAATATTTTCTATGGG
CTTGTTTTGGTTATATTTTCCTTTGGGGTGGACTTTCTGCTCATAGCCATCTCTTATGCT
CTGATATTCCAAGCAGTTATGGGGATCGCTTCCAGAGAAGGTCAGATGAAGGCGCTCAAT
ACTTGTTTGTCTCACATCTTCATTGTCTTTATTTACTACGGTCCTTTGCTGGCAATAACT
GTGATGCATCGGATCAGCCACAGAAGTTCTCCAGTAGCACATGCAGTCCTGGGAAACATC
TATCTCTTTATGCCCCCGATGTTCAACCCAATAGTATATAGCCTGAAGACCAAGCAGATT
CGTTCTGCCCTGAGAAAATCTTTGAAGATCCAGAGAAGA


Conceptual translation

MSEFNTTFQPYVFILTGLRGLVGARLWLGPLLSLMYITTLAGNCTVIYLVRTERSLQEPQ
YHFLSMLAGADIVLSVSTLFSVLKVFIFDFYEIAFDSCLAQLFFIHASSSMGSGILLAMA
FDRFVAISHPLQYTTILTSSRVTKMGLAAFLRGVALMMPLPILLKRLPFCKGQMLSYSYC
IHPNVMKLACGQVKINIFYGLVLVIFSFGVDFLLIAISYALIFQAVMGIASREGQMKALN
TCLSHIFIVFIYYGPLLAITVMHRISHRSSPVAHAVLGNIYLFMPPMFNPIVYSLKTKQI
RSALRKSLKIQRR