Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51ai2 Olfactory Receptor

Gene Symbol Or51ai2
Organism Mouse
Family 51
Subfamily ai
Pseudo No
Location chr7:103,937,000-103,938,000 (+)
Aliases Olfr632

Sequence information


Nucleotide sequence

MKVSIPPRANFSYAIFLLTGFPGLEWAHHWISLPIFMGYFVAIMGNATILHLVRTDPSLH
QPMYYFLAILAVTDLGLCMSTLPSVLGVLWFDARMVGLVPCVLQQHFLHSFSFMESAVLF
AMALDRLIAIRFPLRYASVLTGPRVALIGTVLGMRSAAITAAPSLHLLTFDYCHPGALSH
AYCLHQDMIRLACSDTRFNRLYGLCIIMLAMGSDVLFILLSYAVILRTVLAIASAGERLK
ALNTCVSHILAVLCFYVPVLGLSIVHRFGQHTSPLVHILMGTVSVLFPPVMNPVIYSIKT
QQIRRAIVKVISLGKIQ


Conceptual translation

MKVSIPPRANFSYAIFLLTGFPGLEWAHHWISLPIFMGYFVAIMGNATILHLVRTDPSLH
QPMYYFLAILAVTDLGLCMSTLPSVLGVLWFDARMVGLVPCVLQQHFLHSFSFMESAVLF
AMALDRLIAIRFPLRYASVLTGPRVALIGTVLGMRSAAITAAPSLHLLTFDYCHPGALSH
AYCLHQDMIRLACSDTRFNRLYGLCIIMLAMGSDVLFILLSYAVILRTVLAIASAGERLK
ALNTCVSHILAVLCFYVPVLGLSIVHRFGQHTSPLVHILMGTVSVLFPPVMNPVIYSIKT
QQIRRAIVKVISLGKIQ