Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51b4 Olfactory Receptor

Gene Symbol Or51b4
Organism Mouse
Family 51
Subfamily b
Pseudo No
Location chr7:103,881,000-103,882,000 (-)
Aliases Olfr66

Sequence information


Nucleotide sequence

MWPNSSDAPFLLTGFLGLEMIHHWISIPFFVIYFSIILGNGTLLFIIWSDHSLHEPMYYF
LAVLASMDLGMTLTTMPTVLGVLVLNQREIAQGACFIQSYFIHSLAIVESGVLLAMSYDR
FVAICTPLHYNSILTNSRVMKMALGALLRGFVSIVPPIMPLFWFPYCHSHVLSHAFCLHQ
DVMKLACADITFNLIYPVVLVALTFFLDALIIIFSYVLILKTVMGIASGEERKKSLNTCV
SHISCVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPIIYSIKTKQIQRS
VLRLLSKHSRT


Conceptual translation

MWPNSSDAPFLLTGFLGLEMIHHWISIPFFVIYFSIILGNGTLLFIIWSDHSLHEPMYYF
LAVLASMDLGMTLTTMPTVLGVLVLNQREIAQGACFIQSYFIHSLAIVESGVLLAMSYDR
FVAICTPLHYNSILTNSRVMKMALGALLRGFVSIVPPIMPLFWFPYCHSHVLSHAFCLHQ
DVMKLACADITFNLIYPVVLVALTFFLDALIIIFSYVLILKTVMGIASGEERKKSLNTCV
SHISCVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPIIYSIKTKQIQRS
VLRLLSKHSRT