Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51b6 Olfactory Receptor

Gene Symbol Or51b6
Organism Mouse
Family 51
Subfamily b
Pseudo No
Location chr7:103,906,000-103,907,000 (+)
Aliases Olfr65

Sequence information


Nucleotide sequence

MPSMWLNISSSPFLLTGFPGLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPM
YYFLGMLAATDLGVTLTTMPTVLSVLWLNHREIGHGACFSQAYFIHTLSIVESGVLLAMA
YDRFIAIRNPLRYTTILTDTKVIKIGIGVVMRAGLSIMPIIIRLHWFPYCRSHVLSHAFC
LHQDVIKLACADITFNRLYPVVVVFAMVLLDFLIIFFSYVLILKTVMGIASTDERAKALN
TCVSHICCILVFYVTVVGLTFIHRFGKNVPHVVHITMSYVYFLFPPFMNPVIYSIKTKQI
QSGLLRLFSLPCSKT


Conceptual translation

MPSMWLNISSSPFLLTGFPGLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPM
YYFLGMLAATDLGVTLTTMPTVLSVLWLNHREIGHGACFSQAYFIHTLSIVESGVLLAMA
YDRFIAIRNPLRYTTILTDTKVIKIGIGVVMRAGLSIMPIIIRLHWFPYCRSHVLSHAFC
LHQDVIKLACADITFNRLYPVVVVFAMVLLDFLIIFFSYVLILKTVMGIASTDERAKALN
TCVSHICCILVFYVTVVGLTFIHRFGKNVPHVVHITMSYVYFLFPPFMNPVIYSIKTKQI
QSGLLRLFSLPCSKT