Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51b6b Olfactory Receptor

Gene Symbol Or51b6b
Organism Mouse
Family 51
Subfamily b
Pseudo No
Location chr7:103,660,000-103,661,000 (-)
Aliases Olfr623

Sequence information


Nucleotide sequence

MPVIWLNTSTYPFLLTGFPGLEKSHHLISLPLLMAYIFILLGNGTLLFLIKDDHNLHEPM
YYFLGMLAATDLGVTLTTMPTVLGVLWFNHREIGHGACFSQAYFIHSFSIVESGVLLAMA
YDRFIAIRNPLRYTTILTDIKVIKIGIGVVMRAGLSIMPIIIRLNWFPYCRSHVLSHAFC
LHQDVIKLACADITFNRLYPIVVVFCMGLLDFLIICFSYILILKTVMGIASTDERAKALN
TCVSHICCILVFYVTVVGLTFIHRFGKNIPHIVHITMSYICFLFPPFMNPVIFSIKTKQI
QSGLLRLFSLPYSRTRL