Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51b6c-ps Olfactory Receptor

Gene Symbol Or51b6c-ps
Organism Rat
Family 51
Subfamily b
Pseudo Yes
Location chr1:168,748,000-168,748,000 (-)
Aliases Olr116-ps

Sequence information


Nucleotide sequence

CTCAACACCTCAAGCTGTCCATTCCTGCTCAGTGGCTTCCCAGGTCTGGAGAAAGCCCAT
CACCTGATCTCTCTCCCATTACTGATGGCTTATATCTCCATCCTGCTTGGCAATGGCACC
CTCCTTTTCCTCATTAAAGATGATCATAACCTCCATGAACCCATGTAATATTTCTTAGGT
ATGTTGGCAGCTACGGATCTTGGAGTAACACTGACCACCATGCCCACAGTTCTGGGTGTA
CTGTGGTTAAATCACAGGGAAATTGGCCATGGAGCCTGCTTCTCTCAGGCCTACTTTATC
CATACTCTCTCTATTGTGGAGTCAGGGGTCTTGCTTGCCATGGCCTATGATTGTTTTGTT
GCCATTCGCAACCCATTAAGGTATACCACCATCCTTACTGATACTAGGGTAATAAAGATT
GGCATAGGTGTAGTGATGAGGGCTGGTCTGTCAATCATGCCAATAATCATTCGCCTGCAC
TGGTTTCCCTATTGTCAATCCCATGTACTCTCCCATGCTTTCTGTCTACACCAAGATATC
ATCAAGCTAGCCTGTGCTGACATCACATTCAATCATCTCTATCCAGTTGTGGTTGTATTT
TTCACAGGACTCTTGGATTTTTTTATTATTTGTTTTTCTTACATTTTGATTCTCAAGACT
GTCATGGGCATTGCTTCTACAGATGAGAGGGCTAAAGCTCTCAACACATGTGTCTCCCAC
ATCTGTTGCATCCTGGTTTTCTATGTCACTGTGGTTGGTTTGACATTTATTCACAGGTTT
GGTAAGAATATTCCTCATATTGTTCATATCACAATGAGTTATATCTACTTCCTCTTCCCC
CCTTTTATGAACCCTGTCATCTTCAGCATTAAGACCAAGCAGATTCAGATCAGTTTGCTT
CGCTTGTTCTCACTGTCTTATTCTAGAACTCGA


Conceptual translation

LNTSSCPFLLSGFPGLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPM*YFLG
MLAATDLGVTLTTMPTVLGVLWLNHREIGHGACFSQAYFIHTLSIVESGVLLAMAYDCFV
AIRNPLRYTTILTDTRVIKIGIGVVMRAGLSIMPIIIRLHWFPYCQSHVLSHAFCLHQDI
IKLACADITFNHLYPVVVVFFTGLLDFFIICFSYILILKTVMGIASTDERAKALNTCVSH
ICCILVFYVTVVGLTFIHRFGKNIPHIVHITMSYIYFLFPPFMNPVIFSIKTKQIQISLL
RLFSLSYSRTR