Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51c4 Olfactory Receptor

Gene Symbol Or51c4
Organism Rat
Family 51
Subfamily c
Pseudo No
Location chr1:167,957,000-167,957,000 (+)
Aliases Olr54-ps

Sequence information


Conceptual translation

MSTFQNTTASSIIFLLTGLPGLEALHTWISIPFCFLYAMALSGNSLILFAIISQPSLHEP
MYYFLSMLSTTDLGLSISTMVTMLGIFWFNAREISFNACLSQMFFIQLFTVMESSVLLAM
AYDRYVAISNPLRYALVLTDLKIVQIGIAIITRGTLILTPMVVLLKRLYYCRSHVLHHSY
CFHPDVMKLSCTDTRINSAVGLTALISTAGVDSVFIVLSYVLIIRTVLSIASPEERKKAF
STCISHIGAVAVFYIPLLSLSFVHRFGRRAPPYVHTLIANAYLLIPPVMNPIIYSVKTKQ
IRKAVLKVLRSSMAKS