Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51c4b-ps Olfactory Receptor

Gene Symbol Or51c4b-ps
Organism Rat
Family 51
Subfamily c
Pseudo Yes
Location chr1:167,918,000-167,919,000 (-)
Aliases Olr58-ps

Sequence information


Nucleotide sequence

ATGTCAACCTTCCAGAACACCACAGCTTCCTCCATCATTTTCCTGCTCACTGGGGTGCCC
GGGCTGGAAGCCTTGCACACCTGGATCTCCATTCCCTTCTGCTTTCTCTATGCAATGGCC
CTGTCAGGGAACAGCCTGATTCTCTTCGCCATTATCTCTCAGCCCAGCCTCCATGAGCCC
ATGTATTACTTCCTCTCCATGCTGTCCACCACTGACCTTGGGCTCTCCATATCCACCATG
GTCACCATGCTGGGGATATTCTGGTTCAATGCCAGGGAGATCAGCTTCAATGCCTGCTTG
TCACAGATGTTCTTCATTAAACTCTTCACTGTCATGGAATCCTCTGTGCTACTGGCTATG
GCTTATGATCGCTATGTGGCCATCTCCAACCCTCTTAGATATGCCACTATTTTAACTGAC
TCCAGAATAGCTCAAATTGGGGTGGCAATTGTCATCAGAGGGACTGTAACATTGACACCA
ATGGTTGCACTTCTTAAAAGATTAACCTTCTGCAGTAGCCACGTGCTCCACCACTCCTAC
TGTTTCACC


Conceptual translation

MSTFQNTTASSIIFLLTGVPGLEALHTWISIPFCFLYAMALSGNSLILFAIISQPSLHEP
MYYFLSMLSTTDLGLSISTMVTMLGIFWFNAREISFNACLSQMFFIKLFTVMESSVLLAM
AYDRYVAISNPLRYATILTDSRIAQIGVAIVIRGTVTLTPMVALLKRLTFCSSHVLHHSY
CFT/DVMKLSCTDTRINNVVGLTAMISTVGVDLILILLSYVLIIRTVLSIASSEERKKS
FSTCISHIGAVAIFYIPLISLSFVHRFGKRAPPYVHTMIANTYLLIPPVMNPIIYSVKTK
QIRKAVIKVLQSKEI