Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51c4c-ps Olfactory Receptor

Gene Symbol Or51c4c-ps
Organism Mouse
Family 51
Subfamily c
Pseudo Yes
Location chr7:102,781,000-102,782,000 (+)
Aliases Olfr562-ps1

Sequence information


Nucleotide sequence

MSTLENTTASSIIFLLTGMPGLEAFHTWISIPFCFLYATALSGNSLILFAIITQPSLHEP
TYYFLSMLSTTDLGLSISTLATMLGIFWFNAREISFNACLSQMFFIQLFTVMESSVLLAM
AFDRYVAISNPLRYASVLTDVKIVVIGVAIITRGTLIQTPLAVLLKRLSF*SSHVLHHSY
CFHPDIMKLSCTDTRINSAVGLTALISTAGVDSVFIILSYVLIIRTVLSIASPEERKKAF
STCISHIGAVAVFYIPLISL/YLCPQIWETSST\NVHTLIANAYLLIPPVMNPIIYSVKT
KQIRKAVLKVL


Conceptual translation

MSTLENTTASSIIFLLTGMPGLEAFHTWISIPFCFLYATALSGNSLILFAIITQPSLHEP
TYYFLSMLSTTDLGLSISTLATMLGIFWFNAREISFNACLSQMFFIQLFTVMESSVLLAM
AFDRYVAISNPLRYASVLTDVKIVVIGVAIITRGTLIQTPLAVLLKRLSF*SSHVLHHSY
CFHPDIMKLSCTDTRINSAVGLTALISTAGVDSVFIILSYVLIIRTVLSIASPEERKKAF
STCISHIGAVAVFYIPLISL/LCPQIWETSST\VHTLIANAYLLIPPVMNPIIYSVKT
KQIRKAVLKVL