Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51c4c-ps Olfactory Receptor

Gene Symbol Or51c4c-ps
Organism Rat
Family 51
Subfamily c
Pseudo Yes
Location chr1:167,944,000-167,945,000 (+)
Aliases Olr56

Sequence information


Conceptual translation

MSTSENTTASSIIFLLTGVPGLEALHTWISIPFCFLYATALSGNSLILFAIISQPSLHEP
MYYFLSMLSTTDLGLSISTMVTMLGIFWFNAREISFNACLSQMFFIQLFTVMESSVLLAM
AYDRYVAITNPLRYASVLTDLKIVVIGVAIITRGTLIQTPLAVLLKRLSYCRSHVLHHSY
CFHPDIMKLSCTDTRINSAVGLTALISTAGVDSVFIVLSYVLIIRTVLSIASPEERKKAF
STCISHIGAVAVFYIPLLSL/LCPQIWETSSTLC\TLIANAYLLIPPVMNPIIYSVKT
KQIRKAVLKVLSSSMTKS