Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51d1 Olfactory Receptor

Gene Symbol Or51d1
Organism Mouse
Family 51
Subfamily d
Pseudo No
Location chr7:102,698,000-102,699,000 (+)
Aliases Olfr557

Sequence information


Nucleotide sequence

MPQPLVPLIATPNGSLAHPAYFLLVGIPGLGSKIHFWLAFPLCFMYAVATLGNLAIIFII
RVERRLHEPMYLFLAMLSTIDLVLSSVTMPKMASLFLTGIQEIEFNICLTQMFLIHALSA
MESAVLLAMAFDRFVAICYPLRHASVLTGTTVAKIGLASLARGFVFFFPLPFLLKRLSYC
QTHTVTHSFCLHQDIMKLSCTDTKVNVVYGLFIILSVMGVDSLFIGFSYILILRAVLELS
TRGAALKAFNTCISHLCAVLVFYVPLIGLSVVHRLGGPTSLVHVVMANIYLLLPPVVNPI
VYGAKTKEIRSRVIRMFSQDGR


Conceptual translation

MPQPLVPLIATPNGSLAHPAYFLLVGIPGLGSKIHFWLAFPLCFMYAVATLGNLAIIFII
RVERRLHEPMYLFLAMLSTIDLVLSSVTMPKMASLFLTGIQEIEFNICLTQMFLIHALSA
MESAVLLAMAFDRFVAICYPLRHASVLTGTTVAKIGLASLARGFVFFFPLPFLLKRLSYC
QTHTVTHSFCLHQDIMKLSCTDTKVNVVYGLFIILSVMGVDSLFIGFSYILILRAVLELS
TRGAALKAFNTCISHLCAVLVFYVPLIGLSVVHRLGGPTSLVHVVMANIYLLLPPVVNPI
VYGAKTKEIRSRVIRMFSQDGR