Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51e1 Olfactory Receptor

Gene Symbol Or51e1
Organism Rat
Family 51
Subfamily e
Pseudo No
Location chr1:167,870,000-167,871,000 (+)
Aliases Olr63

Sequence information


Nucleotide sequence

ATGGGAAGCCCCAGTGGCAATGAATCCAGTGTCACATATTTCATCTTAATAGGCCTCCCA
GGATTAGAAGAGTTCCAGTTTTGGTTGGCTTTCCCATTATGTTCCCTCTACCTTATTGCT
GTGCTAGGTAACTTGACGATCATCTACATTGTGAGGACAGAGCACAGACTACATGAGCCC
ATGTATATCTTTCTTTGCATGCTTTCTGGCCTTGACATCCTCATTTCCACCTCATCCATG
CCAAAAATGATGGCCATTTTCTGGTTCAATTCCACCACCATCCAGTTTGATGCTTGTTTG
ATACAGATGTTTGCCATCCATTCCTTATCTGGCATGGAGTCCACAGTGCTGCTGGCCATG
GCCTTTGATCGCTATGTGGCCATCTGTCATCCACTACGGCATGCCACTGTGCTTACATTG
CCTCGTGTTGCGAAGATTGGCATGGCTGCTGTGGTCCGGGGTGCAGCACTAATGGCACCC
TTACCTGTCTTCATCAAGAGGTTGCCTTTCTGTCGTTCCAACATCCTTTCTCATTCTTAC
TGCCTACACCAAGACGTCATGAAGCTGGCCTGCGCTGACATCCGTGTCAATATCATTTAT
GGACTAATTGTCATCATCTCTGCCATTGGTTTGGACTCACTTTTCATCTCCTTCTCATAT
TTGCTCATCCTCAAGACTGTGTTGGGCTTGACACGTGAAGCCCAGGCAAAAGCGTTTGGC
ACTTGTGTCTCTCATGTGTGTGCTGTTTTCATCTTCTATGTGCCCTTCATTGGATTGTCA
ATGGTGCACCGTTTTAGCAAGAGACATGACTCTCTCCTGCCTGTCATTATGGCTAACATC
TATCTGCTGGTTCCTCCTGTGCTCAACCCCATCGTCTATGGAGTAAAGACAAAGGAGATC
CGGCAGCGCATCCTTCGTCTTTTTCTCATGACCACACACACTTCAGCTCAC


Conceptual translation

MGSPSGNESSVTYFILIGLPGLEEFQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHRLHEP
MYIFLCMLSGLDILISTSSMPKMMAIFWFNSTTIQFDACLIQMFAIHSLSGMESTVLLAM
AFDRYVAICHPLRHATVLTLPRVAKIGMAAVVRGAALMAPLPVFIKRLPFCRSNILSHSY
CLHQDVMKLACADIRVNIIYGLIVIISAIGLDSLFISFSYLLILKTVLGLTREAQAKAFG
TCVSHVCAVFIFYVPFIGLSMVHRFSKRHDSLLPVIMANIYLLVPPVLNPIVYGVKTKEI
RQRILRLFLMTTHTSAH