Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51e2 Olfactory Receptor

Gene Symbol Or51e2
Organism Mouse
Family 51
Subfamily e
Pseudo No
Location chr7:102,742,000-102,743,000 (-)
Aliases Olfr78

Sequence information


Nucleotide sequence

MSSCNFTHATFLLIGIPGLEEAHFWFGFPLLSMYAVALFGNCIVVFIVRTERSLHAPMYL
FLCMLAAIDLALSTSTMPKILALFWFDSREITFDACLAQMFFIHTLSAIESTILLAMAFD
RYVAICHPLRHAAVLNNTVTVQIGMVALVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH
QDVMKLAYTDTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC
VSHISVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDIEAGGNT


Conceptual translation

MSSCNFTHATFLLIGIPGLEEAHFWFGFPLLSMYAVALFGNCIVVFIVRTERSLHAPMYL
FLCMLAAIDLALSTSTMPKILALFWFDSREITFDACLAQMFFIHTLSAIESTILLAMAFD
RYVAICHPLRHAAVLNNTVTVQIGMVALVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH
QDVMKLAYTDTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC
VSHISVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDIEAGGNT