Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51f14 Olfactory Receptor

Gene Symbol Or51f14
Organism Mouse
Family 51
Subfamily f
Pseudo No
Location chr7:103,051,000-103,052,000 (+)
Aliases Olfr583

Sequence information


Nucleotide sequence

MLQMQDNTEFLSNFTSKLPTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVT
QHSLHEPMYYFLSVLSATDLGLTFSTMSTTLRILWFQANEISLDFCIVQMFFLHGFTCTE
SGVLVAMAFDRYVAIYKPLRYTMILMNSRIIQIGFLVIMHTLLLTVPLLLLLKPVSFCKR
NTLSHSYCYHPDVIKLACSDTRANSICGLVDLILTTGVDIPCIVLSYILIIRSVLNIAFS
EERHKAFSTCVSHIAAVAVFYIPTFSLSLVHRYGRSVPKVVHTMMANVYLLLPPVLNPII
YSVKTKQIRKAILSLLFAK


Conceptual translation

MLQMQDNTEFLSNFTSKLPTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVT
QHSLHEPMYYFLSVLSATDLGLTFSTMSTTLRILWFQANEISLDFCIVQMFFLHGFTCTE
SGVLVAMAFDRYVAIYKPLRYTMILMNSRIIQIGFLVIMHTLLLTVPLLLLLKPVSFCKR
NTLSHSYCYHPDVIKLACSDTRANSICGLVDLILTTGVDIPCIVLSYILIIRSVLNIAFS
EERHKAFSTCVSHIAAVAVFYIPTFSLSLVHRYGRSVPKVVHTMMANVYLLLPPVLNPII
YSVKTKQIRKAILSLLFAK