Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51f15 Olfactory Receptor

Gene Symbol Or51f15
Organism Mouse
Family 51
Subfamily f
Pseudo No
Location chr7:103,098,000-103,099,000 (+)
Aliases Olfr585

Sequence information


Nucleotide sequence

MLQMQDNTEFLSNFTSKLSTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVT
QHSLHEPMYYFLSVLSATDLGLTFSTMSTTLRILWFQANEISLDLCIVQMFFLHGFTCTE
SGVLVAMAFDRYVAICKPLRYTMILTNSRIIQIGFLVIMRTLLLIIPLLLLLKPVSFCKR
NTLSHSYCYPDVIKLACSDTRANNICGLVDLILTTGLDIPCIVLSYILIIRSVLNIASSE
ERHKAFSTCVSHIAAVAVFYIPMFSLSLVHRYGRSVPKVVHTMMANVYLLLPPVLNPIIY
SVKTKQIRKAILSLLFAK


Conceptual translation

MLQMQDNTEFLSNFTSKLSTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVT
QHSLHEPMYYFLSVLSATDLGLTFSTMSTTLRILWFQANEISLDLCIVQMFFLHGFTCTE
SGVLVAMAFDRYVAICKPLRYTMILTNSRIIQIGFLVIMRTLLLIIPLLLLLKPVSFCKR
NTLSHSYCYPDVIKLACSDTRANNICGLVDLILTTGLDIPCIVLSYILIIRSVLNIASSE
ERHKAFSTCVSHIAAVAVFYIPMFSLSLVHRYGRSVPKVVHTMMANVYLLLPPVLNPIIY
SVKTKQIRKAILSLLFAK