Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51f15b Olfactory Receptor

Gene Symbol Or51f15b
Organism Rat
Family 51
Subfamily f
Pseudo No
Location chr1:168,224,000-168,225,000 (+)
Aliases Olr77

Sequence information


Nucleotide sequence

ATGCTACAAATGCAGGACAGCAGGGAATTCCTAAGCAACTTCACATCGAAATTGACAACC
TTCTTGTTGACTGGCTTTCCTGGCTTAGAGTCTGCTCATGGCTGGATCTCCATCCCTTTC
TGTTGTCTTTATGCCACTGCCCTCTCTGGCAACAGCATGATCCTCTTTATCATTGTGACC
CAGCACAGTCTGCATGAACCGATGTACTATTTCCTCTCTATGCTCTCTGCCACTGACCTG
GGTTTGACTATTTCTACAATGTCAACCACCTTGAGAATCCTGTGGTTTCAAGCAAACGAA
ATCAGTCTAGATTTATGCATTGTTCAGATGTTTTTTCTCCATGGATTCACATGTATCGAA
TCTGGGGTGCTAGTGGCTATGGCTTTTGACCGTTATGTAGCAATCTGCAACCCTCTTAGA
TATACCATGATTCTTACTAATTCTAGAATCATTCAGATGGGTTTCCTAGTGCTGATGCGC
CCTCTACTATTAATAGTTCCCCTACTTTTGCTCCTTACACCTATCTATTTCTGTAAAAGG
AAGGCCCTTTCCCACCCGTTCTGTTATTATCCAGATGTGATTAAGTTAGCATGTTCAGAC
AGTCGGATCAATAACATCTGTGGACTAGTTTTTCTCATTCTGACCATAGGGGTAGATATT
CCATGCATTGTCTTGTCTTATATACTGATCATTCGCTCTGTCCTCACTATTGCCTCCTCT
GAAGAACAGCACAAGGCCTTCAGTACCTGTGTATCCCACATTGGAGCAGTTGCTGTTTTC
TACATCCCGATGTTTAGCCTGTCTCTGGTTCATCGCTATAATCGGTCAGCGCCCAAAATA
GTCCATTCAATGATGGCTAATGTTTTCCTTCTTTTACCCCCTGTGCTCAACCCCATCATC
TATAGTGTGAAAACAAAACAAATCAGAAAGGCTGTGCTTAGTTTGCTCTTTGCAAAA


Conceptual translation

MLQMQDSREFLSNFTSKLTTFLLTGFPGLESAHGWISIPFCCLYATALSGNSMILFIIVT
QHSLHEPMYYFLSMLSATDLGLTISTMSTTLRILWFQANEISLDLCIVQMFFLHGFTCIE
SGVLVAMAFDRYVAICNPLRYTMILTNSRIIQMGFLVLMRPLLLIVPLLLLLTPIYFCKR
KALSHPFCYYPDVIKLACSDSRINNICGLVFLILTIGVDIPCIVLSYILIIRSVLTIASS
EEQHKAFSTCVSHIGAVAVFYIPMFSLSLVHRYNRSAPKIVHSMMANVFLLLPPVLNPII
YSVKTKQIRKAVLSLLFAK