Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51f2 Olfactory Receptor

Gene Symbol Or51f2
Organism Mouse
Family 51
Subfamily f
Pseudo No
Location chr7:102,877,000-102,878,000 (+)
Aliases Olfr568

Sequence information


Nucleotide sequence

MLILNNTHSQLPTFLLTGIPGLRAAQVWISIPFCLLYLSGNSMILLVIVREQSLHEPMYY
FLSMLSITDLSLSLCTLSTTLGVLWFEAREINLNACIAQMFFLHGFTFMESGVLLAMAFD
RFVAICDPLRYTTILTNARIAQIGTIVLIRNVAVMLPVVLFVKRLSFCSSLVLSHSYCYH
VDVIQLSCTDNRINSVLGLFALFSTTGFDCPCILLSYVLIIRSVLSIASSDERQKAFNTC
ISHISAVAIFYIPLISLSLVHRYGHSAPAFVHTVMANVFLLIPPVLNPIIYSVKTKQIRK
AILKVLNQKQNQL


Conceptual translation

MLILNNTHSQLPTFLLTGIPGLRAAQVWISIPFCLLYLSGNSMILLVIVREQSLHEPMYY
FLSMLSITDLSLSLCTLSTTLGVLWFEAREINLNACIAQMFFLHGFTFMESGVLLAMAFD
RFVAICDPLRYTTILTNARIAQIGTIVLIRNVAVMLPVVLFVKRLSFCSSLVLSHSYCYH
VDVIQLSCTDNRINSVLGLFALFSTTGFDCPCILLSYVLIIRSVLSIASSDERQKAFNTC
ISHISAVAIFYIPLISLSLVHRYGHSAPAFVHTVMANVFLLIPPVLNPIIYSVKTKQIRK
AILKVLNQKQNQL