Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51f4-ps Olfactory Receptor

Gene Symbol Or51f4-ps
Organism Mouse
Family 51
Subfamily f
Pseudo Yes
Location chr7:102,818,000-102,818,000 (-)
Aliases Olfr565-ps1

Sequence information


Nucleotide sequence

MPIFYNSTSPTFLLTGVPGLEWAHPWISIPFCCLYFTALSGNSLILFLVLTEPTLQEPMY
YFLSMLSSTDIGLCISTIVTVLGIFWLNAREISFSACLSQMFFIHLFTFMESSVLLAMAF
DRFVAISNP*RYAAILTHARIAQIGLAIITKATVILTPPVLLLKRLSFCLSRVLHHSYCF
HPDVMKLSCSDTKINSAFGLTAIISTAGVDSIFILLSYALIIRSVLSIASPRERKKAFST
CISHVTAVAIFYIPLISLSFVHRFGKHALPYVPTLIANVYLLIPPVMNPIIYSV/RTKLI
QRAILRLVYCK


Conceptual translation

MPIFYNSTSPTFLLTGVPGLEWAHPWISIPFCCLYFTALSGNSLILFLVLTEPTLQEPMY
YFLSMLSSTDIGLCISTIVTVLGIFWLNAREISFSACLSQMFFIHLFTFMESSVLLAMAF
DRFVAISNP*RYAAILTHARIAQIGLAIITKATVILTPPVLLLKRLSFCLSRVLHHSYCF
HPDVMKLSCSDTKINSAFGLTAIISTAGVDSIFILLSYALIIRSVLSIASPRERKKAFST
CISHVTAVAIFYIPLISLSFVHRFGKHALPYVPTLIANVYLLIPPVMNPIIYSV/TKLI
QRAILRLVYCK