Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51g1 Olfactory Receptor

Gene Symbol Or51g1
Organism Mouse
Family 51
Subfamily g
Pseudo No
Location chr7:102,984,000-102,985,000 (-)
Aliases Olfr578

Sequence information


Nucleotide sequence

MAILYNSSLQKATFFLTGFQGLEEFHGWISIPFCSIYLIVILGNLTILHVIRTDATLHEP
MYYFLAMLALTDLGLCLSTLPTVLGIFWFDAREIGIPACFTQLFFIHTLSLVESSVLLSM
SFDRYVAICNPLRYSTILTPRRIVKMGLSSVLRSALLILPLPFLLKRFHYCRSHVLAHAY
CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYTLILHAVLGKASRQERLRAL
NTCISHICAVLLFYIPMIGLSLVHRFGEHLPRIVHLLMSYVYLLVPPLMNPIVYSIKTKQ
IRQRIIKKFEFIK


Conceptual translation

MAILYNSSLQKATFFLTGFQGLEEFHGWISIPFCSIYLIVILGNLTILHVIRTDATLHEP
MYYFLAMLALTDLGLCLSTLPTVLGIFWFDAREIGIPACFTQLFFIHTLSLVESSVLLSM
SFDRYVAICNPLRYSTILTPRRIVKMGLSSVLRSALLILPLPFLLKRFHYCRSHVLAHAY
CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYTLILHAVLGKASRQERLRAL
NTCISHICAVLLFYIPMIGLSLVHRFGEHLPRIVHLLMSYVYLLVPPLMNPIVYSIKTKQ
IRQRIIKKFEFIK