Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51g1 Olfactory Receptor

Gene Symbol Or51g1
Organism Rat
Family 51
Subfamily g
Pseudo No
Location chr1:168,160,000-168,161,000 (-)
Aliases Olr70

Sequence information


Nucleotide sequence

ATGGTCCTCCTTTACAACAGCAGCCTCCAAAAGGCCACTTTCTTCCTGACAGGCTTTCAA
GATCTGGAAAAGTTCCATGGCTGGATCTCCATTCCCTTCTGCTCCATCTACTTAATAGTG
ATTTTAGGGAACCTTACCATTCTCCATGTCATCCGAACTGACGCCACTCTCCATGAACCC
ATGTACTATTTCTTGGCTATGCTGGCCCTAACAGACTTGGGACTCTGCCTCTCTACACTG
CCCACTGTGCTGGGAATCTTCTGGTTTGATGCCAGAGAGATTGGTATTCCTGCCTGCTTT
ACTCAACTATTCTTCATCCACACCTTGTCTTTAGTGGAGTCATCAGTCCTACTGTCGATG
TCCTTCGACCGCTATGTAGCAATTTGCAACCCACTGCGTTATTCCACCATCCTGACATCC
AGAAGGATTGTGAAGATGGGGCTGAGCTCAGTGCTCAGAAGCGCACTCCTCATTCTCCCA
TTACCATTCCTCCTTAAACGCTTCCATTATTGCCGCTCCCATGTGTTAGCTCATGCCTAC
TGTCTGCATCTGGAGATCATGAAACTAGCTTGCTCCAGCATCATCGTCAATCATATCTAT
GGGCTCTTTGTTGTGGCCTGTACTGTGGGTGTAGACTCCCTACTCATATTCCTCTCATAT
ACTCTCATCCTCCATGCTGTACTAGGCAAAGCCTCCCGTCAGGAGCGCCTCCGTGCTCTC
AATACCTGTATCTCTCATATCTGTGCAGTACTGCTATTCTACATCCCCATGATTGGCTTA
TCCCTTGTACATCGCTTTGGTGAACACCTTCCCCGCATTGTACATATTCTGATGTCTTAT
GTGTATCTGTTGGTGCCACCCCTCATGAACCCCATTGTCTACAGCATCAAGACCAAGCAA
ATACGCCAACGTATTATCAAGAAGTTTGAGTTTGTAAAG


Conceptual translation

MVLLYNSSLQKATFFLTGFQDLEKFHGWISIPFCSIYLIVILGNLTILHVIRTDATLHEP
MYYFLAMLALTDLGLCLSTLPTVLGIFWFDAREIGIPACFTQLFFIHTLSLVESSVLLSM
SFDRYVAICNPLRYSTILTSRRIVKMGLSSVLRSALLILPLPFLLKRFHYCRSHVLAHAY
CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYTLILHAVLGKASRQERLRAL
NTCISHICAVLLFYIPMIGLSLVHRFGEHLPRIVHILMSYVYLLVPPLMNPIVYSIKTKQ
IRQRIIKKFEFVK