Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51h5 Olfactory Receptor

Gene Symbol Or51h5
Organism Mouse
Family 51
Subfamily h
Pseudo No
Location chr7:102,928,000-102,929,000 (+)
Aliases Olfr572

Sequence information


Nucleotide sequence

MADHNHSQSQHLYFILTGIPGLEQKYYWMAFPLGAIYVIALFGNGVIISTIKSESSLHIP
MYYFLCMLAFADMGLTLCTLPSMLGIFWFNYKFITFDGCLVQMYFIHTFSAIESGVLVAM
AIDRVIAIWSPLRYGTILTNGVVCKIGMLILSRAVCVVFPVPFLIKRLPFYRSNILSHSF
CLHQDVMRLACASTRVNSLYGLIAVIFTKGSDSLSILISYVFILRTVMAIASGEGRLKAL
NTCVSHICAVLIFYVPLIGVSVIHRFGKHLSPLTHALMANAYLLVPPVLNPIVYTVKTKE
IRKKIIQIFIRTKITTEG


Conceptual translation

MADHNHSQSQHLYFILTGIPGLEQKYYWMAFPLGAIYVIALFGNGVIISTIKSESSLHIP
MYYFLCMLAFADMGLTLCTLPSMLGIFWFNYKFITFDGCLVQMYFIHTFSAIESGVLVAM
AIDRVIAIWSPLRYGTILTNGVVCKIGMLILSRAVCVVFPVPFLIKRLPFYRSNILSHSF
CLHQDVMRLACASTRVNSLYGLIAVIFTKGSDSLSILISYVFILRTVMAIASGEGRLKAL
NTCVSHICAVLIFYVPLIGVSVIHRFGKHLSPLTHALMANAYLLVPPVLNPIVYTVKTKE
IRKKIIQIFIRTKITTEG