Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51h7 Olfactory Receptor

Gene Symbol Or51h7
Organism Mouse
Family 51
Subfamily h
Pseudo No
Location chr7:102,942,000-102,943,000 (-)
Aliases Olfr573

Sequence information


Nucleotide sequence

MINLNGSLTSHPVFILTGIPGMPDKSLWMVFPLGFLYTLTLLGNGTILAVGEVEQSLHEP
MYYFLCMLALIDISLSMSTLPSMPPEIPFEACVAQMFFIHVFGLVDSGVLLSIIAFDRFV
AIQNPLHYASILTHGVIGKIGLVVLDRAVCVVFPVPFLIKRLPFCHPNILSHSYCLHQDM
MRLACASTRVNSLYGLIIVILILGLDAFIILFSYILILKTVLGISSRAERLKALNTCLSH
ICTVLLFYIPFIGATMIHRFGKHLSPIVHMLMANIYLLLPPLLNPIVYSVKNKQIRG


Conceptual translation

MINLNGSLTSHPVFILTGIPGMPDKSLWMVFPLGFLYTLTLLGNGTILAVGEVEQSLHEP
MYYFLCMLALIDISLSMSTLPSMPPEIPFEACVAQMFFIHVFGLVDSGVLLSIIAFDRFV
AIQNPLHYASILTHGVIGKIGLVVLDRAVCVVFPVPFLIKRLPFCHPNILSHSYCLHQDM
MRLACASTRVNSLYGLIIVILILGLDAFIILFSYILILKTVLGISSRAERLKALNTCLSH
ICTVLLFYIPFIGATMIHRFGKHLSPIVHMLMANIYLLLPPLLNPIVYSVKNKQIRG