Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51i1 Olfactory Receptor

Gene Symbol Or51i1
Organism Mouse
Family 51
Subfamily i
Pseudo No
Location chr7:104,021,000-104,022,000 (-)
Aliases Olfr640

Sequence information


Nucleotide sequence

MLGLNGTPFQPATLQLTGIPGMNTGQAWIALIFCFLYFISIAGNLSILALVIREPPLHQP
MYYFLSMLSLNDLGVSLSTLPTVLATFCFNYRHVDFDACLVQMFFIHTFSFMESGILLAM
SFDRFVAICDPLRYSTVLTNSRILAMGLGILAKSFTTLFPFPFLVKRLPFCKGNVLHHSY
CLHPDLMKVACGDIHVNNIYGLFVVIFTYGVDSVFILLSYALILRAVLVIASHEQRLKAL
NTCISHICAVLAFYVPIIAVSMIHRFWKSAPAVVHVMMSNVYLFVPPMLNPIIYSVKTKE
IRKGMLKVFHKSQT


Conceptual translation

MLGLNGTPFQPATLQLTGIPGMNTGQAWIALIFCFLYFISIAGNLSILALVIREPPLHQP
MYYFLSMLSLNDLGVSLSTLPTVLATFCFNYRHVDFDACLVQMFFIHTFSFMESGILLAM
SFDRFVAICDPLRYSTVLTNSRILAMGLGILAKSFTTLFPFPFLVKRLPFCKGNVLHHSY
CLHPDLMKVACGDIHVNNIYGLFVVIFTYGVDSVFILLSYALILRAVLVIASHEQRLKAL
NTCISHICAVLAFYVPIIAVSMIHRFWKSAPAVVHVMMSNVYLFVPPMLNPIIYSVKTKE
IRKGMLKVFHKSQT