Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51j3 Olfactory Receptor

Gene Symbol Or51j3
Organism Mouse
Family 51
Subfamily j
Pseudo No
Location chr7:103,956,000-103,957,000 (+)
Aliases Olfr634

Sequence information


Nucleotide sequence

MKNYNSSLGFLPTTFILVGIPGLETEHIWISIPFCLMYFIIFLGNGTILHVIRTDASLHQ
PMYLFLAMLALAEVGVSASTLPTVLGIFLFDTSEITFEACLLQMFFIHSFSIMESAVLLA
MSVDRFVAIYSPLRYTTILTLPRIFGTGAVIGLKSVILMAPLPILLRRLPFCGHNALSHS
YCLHPNLIHLPCGDISIDNIYGLFIVTSTFGLDSLLIVVSYGLILHTVLGIATGDGRRKA
LNTCGSHVCAVLAYYVPMIGLSMVHRFAHHVSPLLQTMMANAYLFFPPSHQPHCLQHQNQ
GDPSWHCSNAVREEVQSLVEDVKIGGCLVGFYHHVLSAYFYT


Conceptual translation

MKNYNSSLGFLPTTFILVGIPGLETEHIWISIPFCLMYFIIFLGNGTILHVIRTDASLHQ
PMYLFLAMLALAEVGVSASTLPTVLGIFLFDTSEITFEACLLQMFFIHSFSIMESAVLLA
MSVDRFVAIYSPLRYTTILTLPRIFGTGAVIGLKSVILMAPLPILLRRLPFCGHNALSHS
YCLHPNLIHLPCGDISIDNIYGLFIVTSTFGLDSLLIVVSYGLILHTVLGIATGDGRRKA
LNTCGSHVCAVLAYYVPMIGLSMVHRFAHHVSPLLQTMMANAYLFFPPSHQPHCLQHQNQ
GDPSWHCSNAVREEVQSLVEDVKIGGCLVGFYHHVLSAYFYT