Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51k1 Olfactory Receptor

Gene Symbol Or51k1
Organism Mouse
Family 51
Subfamily k
Pseudo No
Location chr7:104,012,000-104,013,000 (-)
Aliases Olfr639

Sequence information


Nucleotide sequence

MGAENNESLDLLSIFLTGIPGLEAQHGWLSIPFFIMYIVAIVGNSLIMIAVQQESALHEP
MYLFLSMLAITEVGVSVSTLPTVMGILWFNAYRIDFDGCLAQMFFIHTFSGMESGVLLAM
SYDRFVAIYNPLRYTAILTLPRIISMGLGITLKSVALMAPLPILLKQLPYCHINILSHSY
CLHSDLIQLPCADTRLNSILGLAIVLATFGLDSLLIVVSYGLILYTVMGIASGEGRKKTL
NTCVSHICAVLIYYVPMIGVSVMHRVAKHASPVVHTLMSSIYLFVPPVLNPIIYSVKTRP
IQQGIANLFSCKKGSI


Conceptual translation

MGAENNESLDLLSIFLTGIPGLEAQHGWLSIPFFIMYIVAIVGNSLIMIAVQQESALHEP
MYLFLSMLAITEVGVSVSTLPTVMGILWFNAYRIDFDGCLAQMFFIHTFSGMESGVLLAM
SYDRFVAIYNPLRYTAILTLPRIISMGLGITLKSVALMAPLPILLKQLPYCHINILSHSY
CLHSDLIQLPCADTRLNSILGLAIVLATFGLDSLLIVVSYGLILYTVMGIASGEGRKKTL
NTCVSHICAVLIYYVPMIGVSVMHRVAKHASPVVHTLMSSIYLFVPPVLNPIIYSVKTRP
IQQGIANLFSCKKGSI