Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51k2 Olfactory Receptor

Gene Symbol Or51k2
Organism Mouse
Family 51
Subfamily k
Pseudo No
Location chr7:103,947,000-103,948,000 (+)
Aliases Olfr633

Sequence information


Nucleotide sequence

MSGYICGPVKPKSPDIKHRKMFNSSQFTPKYFLLTGFPGLEAWYPWLIFPFCFTYTIGIM
GNTLILAVIRKNSSLHQPMFLFLAMLAFSELGVSASTLPTVLSIFLLGANKICFEACLLQ
MFSIHSFSIMESGVLLAMSVDRFVAIYNPLRYTAILTLPRIAGTSLTLGLKSLLLMFPLP
FLLKRLPFCGHNVLSHSYCLHSDLIQLPCGDTRPNSILGLCIVTSTFGLDSLLIVVSYVL
ILYTVLNITSGEGRRKALNTCVSHMCAVLVYYVPMISVALVHRFMKHAVPAVRLLLANIY
LLVPPMLNPIIYSAKNRQIRQGLIQLFLQRKY


Conceptual translation

MSGYICGPVKPKSPDIKHRKMFNSSQFTPKYFLLTGFPGLEAWYPWLIFPFCFTYTIGIM
GNTLILAVIRKNSSLHQPMFLFLAMLAFSELGVSASTLPTVLSIFLLGANKICFEACLLQ
MFSIHSFSIMESGVLLAMSVDRFVAIYNPLRYTAILTLPRIAGTSLTLGLKSLLLMFPLP
FLLKRLPFCGHNVLSHSYCLHSDLIQLPCGDTRPNSILGLCIVTSTFGLDSLLIVVSYVL
ILYTVLNITSGEGRRKALNTCVSHMCAVLVYYVPMISVALVHRFMKHAVPAVRLLLANIY
LLVPPMLNPIIYSAKNRQIRQGLIQLFLQRKY