Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51k2 Olfactory Receptor

Gene Symbol Or51k2
Organism Rat
Family 51
Subfamily k
Pseudo No
Location chr1:169,116,000-169,117,000 (+)
Aliases Olr135

Sequence information


Nucleotide sequence

ATGTCAGGTTATATCCGTGGCACTGACAAACCAAAGTCCTCAGAGGAGTCCAAGCACAGG
AAAATGTTCAACAGCAGTCAGTTCACCCCAGAATATTTTCTGCTGACTGGTTTCCCTGGT
CTGGAAGCATGGTACCCTTGGCTGATCTTGCCATTCTGCTTCACGTATGTTATAGGCATT
GTGGGCAACACCCTCATTCTGACTGTGATCAGGAAAAACAGTTCTCTGCACCAGCCGATG
TTCTTGTTCCTGGCTATGCTGGCCTTCTCCGAGCTCGGTGTCTCTGCTTCAACCCTGCCC
ACGGTGCTAAGCATCTTTCTATTTGGTGCCAATAAAATCTGCTTTGAAGCCTGCCTTTTG
CAGATGTTCTCCATACATTCATTTTCCATCATGGAGTCAGGAGTTCTTCTAGCCATGTCT
GTGGATCGCTTTGTTGCCATCTACAACCCACTCCGCTACACTACCATCCTGACTCTGCCC
CGTATTGCTGGTACCGGTGTTACACTTGGACTGAAAAGTCTGTTGCTCATGTTCCCCCTG
CCTTTTCTCCTAAAGTCTCTGCCTTTCTGCAGCCACAATGTGCTCTCCCATTCCTATTGT
CTGCACTCAGATCTAATCCAGCTGCCCTGTGGGGACACTCGTCCCAACAGCATTTTGGGG
CTCTGCATCGTGACTTCCACTTTTGGGCTGGACTCACTGCTCATTGTTGTCTCTTATGTG
CTGATCCTGTACACAGTACTTAACATTACCTCTGGGGAGGGGCGGAGGAAAGCTCTCAAT
ACTTGTGTGTCACATATGTGTGCAGTTCTGGTGTACTACGTGCCTATGATCAGCGTGGCT
CTGGTGCATCGCTTCATGAAGCATGCTGTACCTGCTGTCCGCCTGCTTCTGGCCAACATC
TATCTTCTGGTACCACCAATGCTCAACCCCATCATCTACAGTGCTAAGAACAGGCAGATT
CGCCAGGGGTTAATACAACTCTTTCTTCAAAGAAAATAT


Conceptual translation

MSGYIRGTDKPKSSEESKHRKMFNSSQFTPEYFLLTGFPGLEAWYPWLILPFCFTYVIGI
VGNTLILTVIRKNSSLHQPMFLFLAMLAFSELGVSASTLPTVLSIFLFGANKICFEACLL
QMFSIHSFSIMESGVLLAMSVDRFVAIYNPLRYTTILTLPRIAGTGVTLGLKSLLLMFPL
PFLLKSLPFCSHNVLSHSYCLHSDLIQLPCGDTRPNSILGLCIVTSTFGLDSLLIVVSYV
LILYTVLNITSGEGRRKALNTCVSHMCAVLVYYVPMISVALVHRFMKHAVPAVRLLLANI
YLLVPPMLNPIIYSAKNRQIRQGLIQLFLQRKY