Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51k3-ps Olfactory Receptor

Gene Symbol Or51k3-ps
Organism Mouse
Family 51
Subfamily k
Pseudo Yes
Location chr7:103,989,000-103,990,000 (-)
Aliases Olfr636-ps1

Sequence information


Nucleotide sequence

MKFLTGIPGLETQHGWLSIPIFIMYMVAIVGHSLIMAAVQQVSVFHEPMYLFFYMLAINE
VGVSESTMPTVRSSLW/SCANRIDLDGCLAQMLFIHTFSGMGSGVLLTMSYEDFVTIYNP
LRHTAFLTLPRIISMGLGITLKSVTLMAPLQILLKQRPYCHINILSHSYGLHADLIQLPC
ADTRLNSILRLTIVLATFGLDSLFIVVSYGLILYTVMGIASGEGRKKALNTCVSHICAVL
IYYVPMIGVSMMHRVAKHASPVVHTLMLSIYLFVPPVLNPIIYSVKTRPIQQGIANLFSC
KKGSI


Conceptual translation

MKFLTGIPGLETQHGWLSIPIFIMYMVAIVGHSLIMAAVQQVSVFHEPMYLFFYMLAINE
VGVSESTMPTVRSSLW/CANRIDLDGCLAQMLFIHTFSGMGSGVLLTMSYEDFVTIYNP
LRHTAFLTLPRIISMGLGITLKSVTLMAPLQILLKQRPYCHINILSHSYGLHADLIQLPC
ADTRLNSILRLTIVLATFGLDSLFIVVSYGLILYTVMGIASGEGRKKALNTCVSHICAVL
IYYVPMIGVSMMHRVAKHASPVVHTLMLSIYLFVPPVLNPIIYSVKTRPIQQGIANLFSC
KKGSI