Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51l14 Olfactory Receptor

Gene Symbol Or51l14
Organism Mouse
Family 51
Subfamily l
Pseudo No
Location chr7:103451339-103452295 (+)
Aliases Olfr606, MOR17-2

Sequence information


Nucleotide sequence

ATGGCACCGTCAAATTCCAGTGTCAGTGTGTCCTCCACATTCTATCTCACAGGTATCCCT
GGCTATGAGGAATTTCACCACTGGATTTCCATCCCATTCTGCCTTATCTACATTATTGGG
GTAACAGGGAACTGTTCCATCTTGCACATTGTACGAACTGACCCCAAACTCCACGAGCCC
ATGTATTACTTCCTGGCTATGCTTTCGCTCACTGACATGGCCATGTCCTTGCCTGCTATG
GTATCACTTTTCAGGGTGTTGTGGTCTATTTCCCGAGAAATCCAGTTTAATATTTGCGTG
GTCCAAATGTTTCTGATTCATACTTTTTCCTTCACTGAGTCATCTGTGCTCTTGGCCATG
GCTCTTGATCGTTACGTGGCTATTTGCCACCCCCTGCGATATGCTACGATTCTCACGCCG
AAACTTATTGCTAAAATTGGAATTGCAGCCTTACTTCGGAGTGCTATTCCACTCATTCCT
CTCCTGGTTCGTCTAGCATTCTTTTCCTTCTGCCGCTCCCATGTCCTTTCTCATTCTTAT
TGTCTGCACCAGGACATAATCCGCCTTGCCTGCGCTGACATCAGGTTTAATGTTATATAC
GGAATGGTGGTGATTCTTATGCTGTGGGGAATGGATTCTTTGGGTATTTTAATAACTTAT
GTTTTCATCCTTCACTCAGTGTTAAGAATTGCATCCCGGGAGGGTAGGCTTAAGGCACTC
AACACATGTGCATCCCATATCTGTGCTGTGCTCATTCTATATGTGCCCATGATAGGGTTG
TCTATCGTCCACCGTTTTGCCAAACATTCCTCTCCCTTTGTTCATATCTTCATGGCTCAT
ATTTACTTAATGGTGCCACCAGTGCTCAACCCAATCATCTATAGTGTGAAGACCAAGCAG
ATCCGACAAGGAATATTCCATTTGATCTGTCCCCACAAAATCAATTCTTCTGCAATG


Conceptual translation

MAPSNSSVSVSSTFYLTGIPGYEEFHHWISIPFCLIYIIGVTGNCSILHIVRTDPKLHEP
MYYFLAMLSLTDMAMSLPAMVSLFRVLWSISREIQFNICVVQMFLIHTFSFTESSVLLAM
ALDRYVAICHPLRYATILTPKLIAKIGIAALLRSAIPLIPLLVRLAFFSFCRSHVLSHSY
CLHQDIIRLACADIRFNVIYGMVVILMLWGMDSLGILITYVFILHSVLRIASREGRLKAL
NTCASHICAVLILYVPMIGLSIVHRFAKHSSPFVHIFMAHIYLMVPPVLNPIIYSVKTKQ
IRQGIFHLICPHKINSSAM