Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51l14 Olfactory Receptor

Gene Symbol Or51l14
Organism Rat
Family 51
Subfamily l
Pseudo No
Location chr1:168,489,000-168,490,000 (+)
Aliases Olr96

Sequence information


Nucleotide sequence

ATGCCTTCCCCATTGGAGAGTAACAGTAGAATCAGACTTCATCATAACGTCCACCCGATG
GCACCCTCAAACTTCAGTGGCATTGTGTCCTCCACATTCTATCTCACAGGCATCCCTGGT
TATGAGGAATTTCACCACTGGATTTCCATCCCATTCTGCCTCATCTACATTGTTGGGGTA
ACAGGAAATTGTTCCATCTTGCATATCGTGCGCACAGATCCGAGGCTCCATGAGCCCATG
TATTACTTCCTCGCTATGCTTTCACTCACTGACATGGCCATGTCCCTGCCTGCTACGGTA
TCACTTTTCAGGGTATTGTGGTCTATTTCCCGAGAAATCCAGTTTAATTTGTGCGTTGTC
CAAATGTTTCTGATTCATACTTTTTCCTTCACTGAATCATCTGTGCTCTTGGCCATGGCC
CTTGACCGTTATGTGGCTATCTGCCACCCCCTGCGATATGCTACCATTCTCACGCCAAAA
CTTATAGCCAAGATTGGAATTGCGGCCTTGCTTCGGAGTGCTATTCCACTCATTCCTCTC
CTGGTTCGTCTAGCATTCTTTTCTTTCTGTCGCTCACACGTTCTTTCTCATTCTTACTGT
TTGCACCAGGATATAATCCGCCTTGCCTGCAATGATATCAGGTTTAACGTAATATATGGA
ATGGTTGTGATTCTTATGCTGTGGGGTATGGATTCTTTGGGTATTTTAATAACTTATGTT
TTCATCCTTCACTCAGTGTTAAGAATTGCATCCCGGGAGGGAAGGCTTAAGGCTCTTAAC
ACATGTGCATCCCACATCTGTGCTGTGCTTATTCTATATGTGCCTATGATAGGGTTGTCT
ATTGTCCACCGTTTTGGCAAACATTCCTCTCCCTTTGTTCATGTCTTCATGGCTCATATC
TACTTAATGGTGCCACCAGTGCTCAACCCAATCATCTATAGTGTGAAGACCAACCAGATC
CGACAAGGAATCCTCCATTTGATTTGTCCCCACAAAATCACTTCTGCAATG


Conceptual translation

MPSPLESNSRIRLHHNVHPMAPSNFSGIVSSTFYLTGIPGYEEFHHWISIPFCLIYIVGV
TGNCSILHIVRTDPRLHEPMYYFLAMLSLTDMAMSLPATVSLFRVLWSISREIQFNLCVV
QMFLIHTFSFTESSVLLAMALDRYVAICHPLRYATILTPKLIAKIGIAALLRSAIPLIPL
LVRLAFFSFCRSHVLSHSYCLHQDIIRLACNDIRFNVIYGMVVILMLWGMDSLGILITYV
FILHSVLRIASREGRLKALNTCASHICAVLILYVPMIGLSIVHRFGKHSSPFVHVFMAHI
YLMVPPVLNPIIYSVKTNQIRQGILHLICPHKITSAM