Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51l4 Olfactory Receptor

Gene Symbol Or51l4
Organism Mouse
Family 51
Subfamily l
Pseudo No
Location chr7:103754627-103755583 (-)
Aliases Olfr630, MOR17-1

Sequence information


Nucleotide sequence

ATGGCAACCTCAAACTCCAGCACCATTGTGTCCTCTACATTCTACCTCACAGGCATCCCT
GGCTATGAGGAATTTCATCACTGGATTTCCATTCCATTTTGCTTCCTTTACCTTGTTGGA
ATAACAGGCAACTGCATGATCCTGCACATTGTGCGGACAGACCCTAGACTCCACGAGCCC
ATGTATTACTTCCTGGCTATGCTTTCACTCACTGACATGGCCATGTCCCTGCCCACCATG
ATGTCACTTTTCAGGGTGTTGTGGTCTATTTCCCGAGAAATCCAGTTTAATATCTGTGTA
GTCCAAATGTTTCTGATTCATACTTTTTCCTTCACTGAATCATCTGTGCTCTTGGCCATG
GCCCTTGACCGTTACGTGGCTATCTGCCATCCCCTGCGATATGCTACCATTCTCACGCCG
AAACTTATTGCCAAGATTGGAACTGCTGCTCTGCTCAGAAGTTCTATTTTGATAATTCCA
CTTATAGCCCGTCTAGCCTTCTTTCCCTTCTGTGGCTCTCATGTTCTTTCTCATTCCTAT
TGTTTGCACCAGGACATGATTCGCCTGGCTTGTGCTGACATCAGATTCAATGTCATATAT
GGACTAGTACTCATTACTTTGCTGTGGGGAATGGACTCCCTGGGCATTTTTGTATCTTAT
GTTTTAATCCTTCACTCAGTGTTAAAAATTGCATCCCGTGAGGGTAGGCTTAAGGCACTC
AACACATGTGCATCCCATATTTGTGCTGTGCTAATTCTATATGTGCCCATGATAGGATTG
TCTATTGTCCATCGTTTTGCCAAACATTCCTCTCCCCTCATTCATATCTTCATGGCTCAT
ATCTACTTATTGGTTCCACCAGTACTTAACCCAATCATCTACAGTGTGAAGACCAAACAG
ATCCGTGAAGGAATCCTCCATTTGCTTTGTTCTCCAAAAATCAGTTCTATTACAATG


Conceptual translation

MATSNSSTIVSSTFYLTGIPGYEEFHHWISIPFCFLYLVGITGNCMILHIVRTDPRLHEP
MYYFLAMLSLTDMAMSLPTMMSLFRVLWSISREIQFNICVVQMFLIHTFSFTESSVLLAM
ALDRYVAICHPLRYATILTPKLIAKIGTAALLRSSILIIPLIARLAFFPFCGSHVLSHSY
CLHQDMIRLACADIRFNVIYGLVLITLLWGMDSLGIFVSYVLILHSVLKIASREGRLKAL
NTCASHICAVLILYVPMIGLSIVHRFAKHSSPLIHIFMAHIYLLVPPVLNPIIYSVKTKQ
IREGILHLLCSPKISSITM