Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51l4 Olfactory Receptor

Gene Symbol Or51l4
Organism Rat
Family 51
Subfamily l
Pseudo No
Location chr1:168,868,000-168,869,000 (-)
Aliases Olr125

Sequence information


Nucleotide sequence

ATGGCAACCTCAAACTCCAGCACAATTGTGTCCTCTACATTCTACCTCACAGGCATCCCT
GGCTATGAGGAATTTCACCACTGGATTTCCATTCCATTTTGCTTTCTTTACCTTATTGGA
ATAACAGGCAACTGTATGATTCTGCATATCGTGCGCACAGATCCCAGGCTCCATGAGCCC
ATGTATTACTTCCTTGCTATGCTTTCACTCACTGACATGGCCATGTCCCTGCCCACGATG
ATTTCACTTTTTAGGGTCTTGTGGTCTATTTCTCGAGAGATCCAGTTTAATATTTGTGTG
GTCCAAATGTTTCTGATTCATACTTTTTCCTTCACTGAATCCTCTGTGCTCTTAGCCATG
GCCCTTGACCGTTATGTGGCTATCTGCCATCCCCTGCGATATGCTACCATTCTCACGCCA
AAACTTATCGCCAAGATTGGAACTGCTGCTCTGCTCAGAAGTTCTATTTTGATAATTCCA
CTGGTGGCCCGTCTCGCCTTCTTTCCCTTCTGTGGCTCCCATGTCCTTTCTCATTCCTAT
TGTTTGCATCAGGACATGATCCGCCTGGCTTGTGCTGACATCAGATTTAATGTCATATAT
GGACTAGTACTCATCACATTGCTGTGGGGCATGGACTCCCTGGGCATTTTTGTATCTTAT
GTTTTAATCCTTCAGTCAGTGTTAAAAATTGCATCCCGTGAGGGTAGACTTAAGGCCCTC
AACACATGTGCATCCCATATTTGTGCTGTGCTCATTCTATATGTGCCCATGATAGGATTA
TCTATTGTTCATCGTTTTGCCAAACATTCCTCTCCCCTCATTCACATCTTCATGGCTCAT
ATCTACTTATTGGTGCCACCAGTGCTCAACCCAATCATCTATAGTGTGAAGACCAAACAG
ATCCGACAAGGAATCCTCCATTTGATTTGTTCGCCCAAAATCAACTCTATTACAATG


Conceptual translation

MATSNSSTIVSSTFYLTGIPGYEEFHHWISIPFCFLYLIGITGNCMILHIVRTDPRLHEP
MYYFLAMLSLTDMAMSLPTMISLFRVLWSISREIQFNICVVQMFLIHTFSFTESSVLLAM
ALDRYVAICHPLRYATILTPKLIAKIGTAALLRSSILIIPLVARLAFFPFCGSHVLSHSY
CLHQDMIRLACADIRFNVIYGLVLITLLWGMDSLGIFVSYVLILQSVLKIASREGRLKAL
NTCASHICAVLILYVPMIGLSIVHRFAKHSSPLIHIFMAHIYLLVPPVLNPIIYSVKTKQ
IRQGILHLICSPKINSITM