Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51m1 Olfactory Receptor

Gene Symbol Or51m1
Organism Mouse
Family 51
Subfamily m
Pseudo No
Location chr7:103,929,000-103,930,000 (+)
Aliases Olfr631

Sequence information


Nucleotide sequence

MVLSNITHFSPMFYLSGFPGLEAFEHWIFIPFFLMYLVAISGNCLILIIIKTNPRLHTPM
YYLLSLLALTDLGLSVSTLPTMVGIFWFNYHGIYFGACQIQMFCIHSFSFMESAVLLVMS
FDRFVAICHPLRYSSIITVQRVMRAGLCVILRGPVALIPIVLLLKDFPYCGPLVLSHSFC
LHQEVIHLACVDTTFNNLYGLSLVVFTVMLDLVLIALSYGFILYTVAGLASQEEQIRAFQ
TCTSHLCAVLVFFVPMMGLSLVHRFGKHAPPAVHLLMANIYLFVPPMLNPVIYSIKTKEI
RKAIIRFLGFRKVNSESWG


Conceptual translation

MVLSNITHFSPMFYLSGFPGLEAFEHWIFIPFFLMYLVAISGNCLILIIIKTNPRLHTPM
YYLLSLLALTDLGLSVSTLPTMVGIFWFNYHGIYFGACQIQMFCIHSFSFMESAVLLVMS
FDRFVAICHPLRYSSIITVQRVMRAGLCVILRGPVALIPIVLLLKDFPYCGPLVLSHSFC
LHQEVIHLACVDTTFNNLYGLSLVVFTVMLDLVLIALSYGFILYTVAGLASQEEQIRAFQ
TCTSHLCAVLVFFVPMMGLSLVHRFGKHAPPAVHLLMANIYLFVPPMLNPVIYSIKTKEI
RKAIIRFLGFRKVNSESWG