Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51p1 Olfactory Receptor

Gene Symbol Or51p1
Organism Mouse
Family 51
Subfamily p
Pseudo No
Location chr7:103,144,000-103,145,000 (+)
Aliases Olfr588

Sequence information


Nucleotide sequence

MSVINDSSLYPRFLLTGFPGLETRYGLISIPIFLVYVTSIAGNITILFIIRTESSLHQPM
YYFLSMLALTDLGLSTTTLPTMFSVFWFQAREIPFNACLVQMYFIHVFSIIESAVLLAMA
FDRFVAIREPLRYAAILTNTVIVGIGLAIAGRALALVFPASFLLKRLQYRVINILSYPFC
LHQDLIKTTVSSRWVSSIYGLMVVIFSMGLDSLLLLLSYILILGTVLSIASKAERIKALN
TCISHICAVLTFYTPMIGLSMIRRYGQNASPIVHVIMANVYLLVPPLMNPIVYSVKTKQI
RDRILRKLKKQKV


Conceptual translation

MSVINDSSLYPRFLLTGFPGLETRYGLISIPIFLVYVTSIAGNITILFIIRTESSLHQPM
YYFLSMLALTDLGLSTTTLPTMFSVFWFQAREIPFNACLVQMYFIHVFSIIESAVLLAMA
FDRFVAIREPLRYAAILTNTVIVGIGLAIAGRALALVFPASFLLKRLQYRVINILSYPFC
LHQDLIKTTVSSRWVSSIYGLMVVIFSMGLDSLLLLLSYILILGTVLSIASKAERIKALN
TCISHICAVLTFYTPMIGLSMIRRYGQNASPIVHVIMANVYLLVPPLMNPIVYSVKTKQI
RDRILRKLKKQKV