Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51q1 Olfactory Receptor

Gene Symbol Or51q1
Organism Mouse
Family 51
Subfamily q
Pseudo No
Location chr7:103,979,000-103,980,000 (+)
Aliases Olfr635

Sequence information


Nucleotide sequence

MLHPSSMSEVTNTTHDPFYFILTGIPGFEDIHLWISIPLFCLYTISIMGNTTILTVIRTE
PSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIREISFEACFAQFFFLHGFSFMES
SVLLAMSFDRYVAICRPLHYASILTSEVIARIGLAIICRCVLAVLPSLFLLKRLPFCHSH
LLSHSYCLHQDMIHLVCADIRVNSWYGFALVLLIIVLDPLLIVLSYALILKSVLNTATWT
ERLRALNNCLSHMLAVLVLYVPMVGVSMTHRFAKHASPLVHVLMANIYLLAPPVMNPIIY
SVKTKQIRQGITRLLLQRKVH


Conceptual translation

MLHPSSMSEVTNTTHDPFYFILTGIPGFEDIHLWISIPLFCLYTISIMGNTTILTVIRTE
PSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIREISFEACFAQFFFLHGFSFMES
SVLLAMSFDRYVAICRPLHYASILTSEVIARIGLAIICRCVLAVLPSLFLLKRLPFCHSH
LLSHSYCLHQDMIHLVCADIRVNSWYGFALVLLIIVLDPLLIVLSYALILKSVLNTATWT
ERLRALNNCLSHMLAVLVLYVPMVGVSMTHRFAKHASPLVHVLMANIYLLAPPVMNPIIY
SVKTKQIRQGITRLLLQRKVH