Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51q1 Olfactory Receptor

Gene Symbol Or51q1
Organism Rat
Family 51
Subfamily q
Pseudo No
Location chr1:169,183,000-169,184,000 (+)
Aliases Olr139

Sequence information


Nucleotide sequence

ATGTTGCATCCATCAAGTATGTCAGAAGTAACTAACACTACTCATGATCCTTTCTACTTC
ATCCTCACGGGCATCCCAGGATTTGAGGCTATCCATCTCTGGATCTCCATCCCCTTCTTC
TGCCTCTACACCATTTCCATCATGGGCAACACCACCATCCTAACCGTCATCCGCACAGAG
CCATCTCTCCACCAGCCCATGTACCTCTTCCTCTCCATGCTGGCCCTCACTGACCTGGGC
CTCACTCTTACCACACTGCCTACTGTCATGCAGCTTCTCTGGTTCAACATTCGGGAAATC
AGCTTTGAGGCCTGCTTTGCACAGTTATTCTTCCTCCACGGGTTCTCCTTCATGGAGTCA
TCTGTTTTATTGGCCATGTCCTTTGACCGTTATGTGGCCATCTGTCGCCCACTCCACTAT
GCCTCCATCCTCACCAGTGAGGTCATTGGTAGAATAGGGTTCGCCATCATTTGCCGCTGT
GTCTTGGCTGTTCTTCCCTCCCTTTTCCTGCTCAAGCGCCTGCCCTTCTGCCATTCCCAC
CTTCTTTCTCACTCTTACTGCCTCCATCAGGATATGATTCACCTGGTCTGCGCTGACATC
AGGGTCAACAGATGGTATGGATTTGCTTTGGTCCTGCTCATTATTGTATTAGACCCTCTG
CTCATTGTACTCTCCTATGCACTTATCCTGAAAAGTGTCCTGAACACAGCCACTTGGGCT
GATCGACTCCGGGCTCTCAACAACTGTCTGTCCCACATACTGGCAGTTCTGGTTCTCTAT
GTACCCATGGTTGGTGTGTCTATGACTCACCGCTTTGCCAAGCATGTCTCTCCACTGGTC
CATGTTCTCATGGCCAATATCTACCTGCTGGCACCTCCTGTGATGAACCCCATCATTTAC
AGTGCAAAGACCAAGCAGATCCGCCAGGGAATCACTCGACTTCTCTTGCAAAGAAAGGTT
CAC


Conceptual translation

MLHPSSMSEVTNTTHDPFYFILTGIPGFEAIHLWISIPFFCLYTISIMGNTTILTVIRTE
PSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIREISFEACFAQLFFLHGFSFMES
SVLLAMSFDRYVAICRPLHYASILTSEVIGRIGFAIICRCVLAVLPSLFLLKRLPFCHSH
LLSHSYCLHQDMIHLVCADIRVNRWYGFALVLLIIVLDPLLIVLSYALILKSVLNTATWA
DRLRALNNCLSHILAVLVLYVPMVGVSMTHRFAKHVSPLVHVLMANIYLLAPPVMNPIIY
SAKTKQIRQGITRLLLQRKVH